(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0621

BA000037.VV0621      Location/Qualifiers
FT   CDS_pept        607369..610092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0621"
FT                   /product="preprotein translocase subunit SecA"
FT                   /note="ATPase, RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93385"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93385"
FT                   /db_xref="GOA:Q7MNU4"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNU4"
FT                   /protein_id="BAC93385.1"
FT                   /translation="MITKLLTKVIGSRNDRTLRRLRKIVKEINNYEPTFEALSDEQLKA
FT                   KTVEFRQRLEQGETLDQLLPEAFATVREASKRVYGMRHFDVQLIGGMVLNAGQIAEMRT
FT                   GEGKTLTATLPAYLNALAGKGVHIVTVNDYLAKRDAETNRPLFEFLGMTVGINVPNMPH
FT                   PAKKEAYQADILYGTNNEFGFDYLRDNMAFRNEDRVQRERFFAVVDEVDSILIDEARTP
FT                   LIISGPAEDSSELYTRINALIPLLQKQDKEDSEEYRGDGHYTVDEKSKQVHLTETGQEF
FT                   VEELMVKNGLMEEGDTLYSPTNISLLHHVNAALRAHVLFEKNVDYIVNEDGEVVIVDEH
FT                   TGRTMPGRRWSEGLHQAVEAKEGVKIQNENQTLASITFQNYFRLYEKLSGMTGTADTEA
FT                   FEFQSIYGLETVVIPTNKPMIRNDMPDVVYRTEAEKFAAIIEDIKARVEKGQPVLVGTV
FT                   SIEKSELLSNALKKAKIKHNVLNAKFHEKEAEIVAEAGKPGAVTIATNMAGRGTDIVLG
FT                   GSWQAKVESMANPTQEQIDEIKAEWKLVHDQVLESGGLHIIGTERHESRRIDNQLRGRS
FT                   GRQGDAGSSRFYLSMEDSLLRIFTSDRMAALIQSGMEEGEAIESKMLSRSIEKAQRKVE
FT                   GRNFDIRKQLLEYDDVANDQRKVVYELRDELMSVDDISDMIEHNRVDVLQGVIDEYIPP
FT                   QSLEDMWDLEGLQERLKNDFDIDAPVKQWLEEDDKLYEEALREKVIDTAVEVYKAKEEV
FT                   VGAQVLRNFEKSVMLQTLDTLWKEHLAAMDHLRQGIHLRGYAQKNPKQEYKRESFELFE
FT                   GLLETLKSDVVMILSKVRVQQQEEVERMEAQRRAQAEEAARRAQAQHASAQSQLADDSD
FT                   EGHHQPVVRDERKVGRNEPCPCGSGKKYKQCHGQIN"
     atgataacta agctactgac aaaggtgatt ggtagtcgca acgatcgcac actgcgccgc        60
     cttagaaaga ttgttaaaga gattaacaac tacgagccga cctttgaggc tctctcagat       120
     gaacaattaa aagcaaaaac ggttgagttt cgccaacgtc tagaacaagg cgaaacgctt       180
     gaccaactat tacctgaagc atttgctacc gttcgtgaag catcaaagcg tgtttacggt       240
     atgcgtcatt tcgatgttca gttgatcggt ggtatggttc tcaatgcagg ccaaatcgct       300
     gaaatgcgta cgggtgaagg taaaacttta accgcaactc ttcctgctta ccttaacgca       360
     ctggctggta aaggtgttca cattgttacc gtcaatgatt acttggcaaa gcgtgacgca       420
     gaaaccaacc gccctctatt tgagtttcta ggaatgaccg ttggcattaa tgtgccaaac       480
     atgcctcatc ctgcgaaaaa agaagcgtac caagccgata tcctatacgg gaccaacaac       540
     gagtttggtt ttgattacct acgcgataac atggctttcc gcaatgaaga tcgcgttcag       600
     cgtgagcgtt tctttgccgt cgtcgatgag gtggactcga tcttgatcga tgaagcgcgt       660
     acaccactta tcatttctgg tcctgctgaa gacagctctg agctttacac gcgtatcaat       720
     gcgctgattc cattattgca gaagcaagat aaagaagact ctgaagagta tcgtggtgat       780
     ggccactaca ctgtcgacga aaaatcgaag caagtgcatc taacggaaac aggccaagag       840
     tttgtggaag agttgatggt gaaaaatggc ctaatggaag agggagatac attgtactct       900
     ccaaccaaca tcagccttct gcatcacgtt aacgcggcat tacgtgcgca tgtcctgttt       960
     gagaagaacg tagactacat cgtaaacgaa gacggtgaag tggtgatcgt tgacgaacac      1020
     actggccgta ctatgccggg tcgtcgttgg tctgaaggtc ttcaccaagc ggttgaagcg      1080
     aaagaaggcg ttaagattca aaacgaaaac cagaccttgg cttcgattac attccagaac      1140
     tacttccgtt tgtatgaaaa actgtctggt atgacgggta cagcggacac cgaagcgttc      1200
     gaattccaat cgatttacgg tcttgagaca gtggttatcc caaccaacaa gccaatgatc      1260
     cgtaacgaca tgccagatgt tgtttatcgt actgaagcag agaaatttgc tgccattatt      1320
     gaagacatca aagcgcgtgt agaaaaaggt caacctgttc tggtgggtac ggtttctatc      1380
     gaaaaatccg agctgctttc gaatgcactg aagaaagcga aaattaaaca caatgttcta      1440
     aatgccaagt tccacgaaaa agaagcggaa attgttgcag aagccggtaa accgggtgcg      1500
     gtgaccattg caaccaacat ggctggtcgt ggtacggaca tcgtgctagg cggtagttgg      1560
     caagcgaaag ttgaatcgat ggctaaccca acgcaagaac agattgatga aatcaaagct      1620
     gagtggaagc tggttcacga tcaagtgctt gagtcgggcg gtctacacat tattggtaca      1680
     gagcgtcacg aatctcgccg tatcgataac cagttgcgcg gtcgctcagg tcgtcagggt      1740
     gatgccggtt catctcgttt ctacctttct atggaagatt cactactccg tatctttact      1800
     tcggatcgca tggcggcatt gattcaaagt ggcatggaag aaggagaagc gatcgaatct      1860
     aagatgcttt ctcgctctat cgaaaaagcg caacgcaaag tggaaggtcg taacttcgat      1920
     attcgtaagc agctacttga gtacgatgat gtggcgaacg atcagcgtaa agtcgtgtat      1980
     gagctacgtg atgagttgat gagtgttgat gacattagcg atatgatcga acacaatcgc      2040
     gttgatgtgc ttcaaggtgt catcgatgaa tacattccac ctcaatcact ggaagacatg      2100
     tgggatcttg aaggcctaca agaacgtcta aagaacgatt tcgatatcga tgctcctgtg      2160
     aagcaatggt tggaagaaga tgacaagctt tacgaagaag cactacgtga aaaagtcatt      2220
     gataccgcgg ttgaagtcta caaagcgaaa gaagaagtgg ttggtgcaca agtgctacgt      2280
     aacttcgaaa aatcagtgat gttacaaacg ttggatacat tgtggaaaga gcacttggcg      2340
     gcgatggatc acttacgtca aggtatccat ctgcgtggtt atgcacaaaa gaacccgaaa      2400
     caggaataca agcgtgagtc gtttgaactg tttgaaggct tgcttgaaac attgaaatct      2460
     gatgttgtga tgattttgtc aaaagttcgt gtgcagcagc aagaagaagt ggagcgtatg      2520
     gaagctcagc gtcgtgctca agctgaagaa gccgctcgcc gtgcacaagc tcaacatgcc      2580
     tcagctcaaa gccagcttgc tgatgattct gacgaagggc atcaccagcc agtggtccgt      2640
     gacgagcgta aagtaggtcg taatgaacct tgcccttgtg gtagtggcaa aaaatacaaa      2700
     cagtgtcacg gtcaaatcaa ttag                                             2724
//

If you have problems or comments...

PBIL Back to PBIL home page