(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0624

BA000037.VV0624      Location/Qualifiers
FT   CDS_pept        611941..613080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0624"
FT                   /product="carbamoylphosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93388"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93388"
FT                   /db_xref="GOA:Q7MNU1"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNU1"
FT                   /protein_id="BAC93388.1"
FT                   /translation="MSKSALLVLEDGTVFRGVSIGADGISVGEVVFNTSMTGYQEILTD
FT                   PSYSQQIVTLTYPHIGNTGTTSEDEESSSIHAQGLVIRDLPLIASNFRSEQSLSDYLKS
FT                   QNIVGIADIDTRKLTRILREKGAQNGCIVAGNNLDEALALAKAKEFPGLKGMDLAKEVT
FT                   TKEAYQWKQGSWTLEGGLPEAKDDSELPYHVVAYDFGAKRNILRMLVDRGCRLTVVPAE
FT                   TSAEDVLALNPDGVFLSNGPGDPAPCTYAIEATKVFLEKGLPVFGICLGHQILALASGA
FT                   KTVKMKFGHHGANHPVKDLDRNVVMITSQNHGFAADEATLPDNLRATHVSLFDGSLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIKQHSA"
     ttgagtaaat cagcactgtt agtcctggaa gatgggacag tgttccgcgg agtgtccatt        60
     ggcgcagatg gtatttccgt tggagaagtc gttttcaata cctcgatgac ggggtatcaa       120
     gaaatcctca ctgatccttc ttattcccag caaatcgtta ctcttactta ccctcacatt       180
     ggcaataccg gaaccacttc cgaagacgaa gaatcctctt ccattcatgc tcaaggcctt       240
     gtgattcgcg atctccctct tattgcttcc aacttccgta gtgaacaatc tctttctgat       300
     tacctcaaat cgcaaaacat tgtcggcatt gctgatattg atacgcgtaa gctcactcgt       360
     attctgcgtg agaaaggtgc acaaaacggt tgtatcgttg caggtaacaa cctagatgaa       420
     gctttggctc tggcgaaagc aaaagaattc ccaggtttaa aaggaatgga tcttgcgaaa       480
     gaggttacaa caaaagaagc gtatcaatgg aaacaaggtt cgtggacgct tgagggtgga       540
     cttccagaag cgaaagatga cagcgaattg ccatatcacg ttgttgccta cgatttcggc       600
     gcaaaacgca acatcttacg aatgttggtt gaccgcggct gccgcttaac ggtcgtgcca       660
     gctgaaacgt cggcagaaga cgttctagcg ctaaacccag atggtgtttt cctgtcaaac       720
     ggccctggtg acccagcacc ttgtacttat gcgattgaag caaccaaagt gttcctagaa       780
     aaaggcctac cagtatttgg tatctgtctt ggccaccaaa ttctcgcgtt ggcgtctggt       840
     gcgaaaacgg tgaagatgaa gtttggtcac cacggtgcaa accatcctgt aaaagattta       900
     gaccgcaatg tggtgatgat tacttcgcaa aaccacggtt ttgccgctga tgaagcaact       960
     ctaccagata acctacgtgc tactcacgta tcgctctttg atggctcttt gcagggaatt      1020
     caccgcacag acaagccagc attcagcttc caaggtcacc cagaagcgag cccaggtcca      1080
     cacgacgcag ctccgctatt tgaccatttc atcgaactga ttaaacaaca cagcgcttaa      1140
//

If you have problems or comments...

PBIL Back to PBIL home page