(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0627

BA000037.VV0627      Location/Qualifiers
FT   CDS_pept        complement(616857..617540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93391"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93391"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR013230"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNT8"
FT                   /protein_id="BAC93391.1"
FT                   /translation="MTNITLSGSVGISGKNQRKDIMAVQEALNLVNSSNPVLKPLVVDG
FT                   KLGIKPEKSKTVNAIIQFQKKYVHLQNPDGRIDVHGKTHVKLSSAILKLKAHQNSSILT
FT                   AHFKWSEFSCNDKDNTPVPQDLRTNVKNLASQLEVIRSEIGKPIKITSAYRTPEYNRKI
FT                   GGATNSLHVTGKAADLQVSGVKPKDLYEKIISLINNGKITQGGVGLYTSFVHYDIRGTS
FT                   ARWGK"
     atgacaaaca taacactatc aggatccgtt ggtatttcag ggaaaaacca acgtaaggac        60
     attatggctg tccaagaagc cttaaattta gtcaactcat caaatccagt attaaaacca       120
     ttagtggttg acggaaagtt agggataaaa cctgaaaaat ctaaaaccgt taacgcgatt       180
     atacagtttc aaaaaaaata cgttcatcta cagaatccag atggaagaat cgacgtccac       240
     ggaaaaacac atgtcaaact ttcttctgcc atattgaaac ttaaggccca tcagaatagc       300
     tctattttga cggcccattt taagtggtcc gaattttctt gcaatgacaa agacaacact       360
     cctgtaccac aagacctcag aacaaatgta aaaaacttag catcacaact agaagtaatt       420
     agaagtgaaa taggaaaacc catcaaaata acaagtgctt atagaacacc tgaatacaac       480
     cgaaagattg gtggtgctac taatagctta catgtaacag gcaaagcagc tgatctacaa       540
     gtgtcaggtg taaaaccaaa agacttatat gagaagatta tatctctaat taataacggc       600
     aagataactc aaggaggggt gggtctctat acttcttttg ttcactacga cattcgcggt       660
     acgtcagcta ggtggggcaa ataa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page