(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0637

BA000037.VV0637      Location/Qualifiers
FT   CDS_pept        complement(623175..623300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0637"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93401"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93401"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNS8"
FT                   /protein_id="BAC93401.1"
FT                   /translation="MGTVGVQDEKTHFNDLRHLSPDRLQQWSLHNDRSNFSALWQ"
     ttgggaacag taggtgtaca ggatgaaaaa actcatttta acgatttgcg ccaccttagc        60
     cctgaccgct tgcagcaatg gagcttacac aatgaccgat cgaacttctc agccttgtgg       120
     caataa                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page