(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0644

BA000037.VV0644      Location/Qualifiers
FT   CDS_pept        639275..641617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0644"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93408"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93408"
FT                   /db_xref="GOA:Q7MNS1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="InterPro:IPR027460"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040642"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNS1"
FT                   /protein_id="BAC93408.1"
FT                   /translation="MKPMKNLAQYYVDLLVKLGIVRFSMLLALALVALAVVVQVGITLV
FT                   LKGNVDDIDIVRSVFFGLLITPWAVYFLSVVVDQLEESRQRLSKLVSKLKDMRSRDQEL
FT                   NVQLQQNIEQLNQEIEERIRAEEAREEAMKDLENEVFQRERTQVELAERTALLRSFIDA
FT                   SPDLIYYRNAEGVFSGCNRAMEELTGKKEHQLVGLSPWDVYSKEVAQQIVDTDQQVFAN
FT                   NRALTYEQWLEYPDGRKHYFELRKVPFYSKDGRHLGLVGFGRDITERKRHEESLEKASR
FT                   DKTTFISTISHELRTPLNGIVGLSRMLLDTRLTDEQRKYMQTINVSAITLGNIFNDIID
FT                   MDKFDRRKLELLPAPLNFEDFVAEIESISALMAEQKGLRFDLERLSELPKAIEVDATRL
FT                   RQVIWNLISNAMKFTKEGGVVMTVSSEVEEDFATIIIEVEDTGIGIPEAELDKIFAMYY
FT                   QVKSGKDNLHAVGTGIGLAVSRQLINMMDGDITVSSEEGFGSTFTISIHVPVIESAPST
FT                   VDKPKTQLYLSIFMVEDIALNVTVARSLLESLGHKVTVAMTGDEAIRSFDPSRYDLVLL
FT                   DIQLPDMTGFDVAAYYRKHYSQLPPLVALTANVLKDKREYLDNGMDEAISKPLAVQAIQ
FT                   DVIEKLIIKQESTTIEMEEAEVVEITTSHVENHILDLVMLESYVEIVGPQPVLDSIRMF
FT                   EEMMPEYLEILDSNMIAKDQPGIVSEAHKIKGAAGSIGLKRIQSVAQKAQSPDMPAWWE
FT                   NIADWVEEIKNEYQNDIQILKSWLEQR"
     atgaaaccga tgaaaaacct tgcccagtat tacgttgatc tactggttaa gctggggatt        60
     gtgcgttttt cgatgttgct agccttggcg ttggttgcat tagctgtggt ggtccaagtg       120
     ggcatcacct tggtgctgaa aggtaatgtg gatgatatcg atattgtccg ctcagtcttt       180
     ttcggtttgc tcattactcc ttgggcggtt tatttcttgt cagtggtggt ggatcaattg       240
     gaagagtcac gccagcgtct ctcaaaattg gtttctaaat tgaaagatat gcgttcacga       300
     gatcaagagc ttaatgttca gttgcaacag aacatcgagc aattgaacca agagatcgaa       360
     gaacgtattc gcgccgaaga agccagagaa gaggcaatga aagatctcga aaacgaggtg       420
     tttcaacggg aacggaccca agtggaactt gcggagcgta cggcgttatt gcgctctttt       480
     attgatgcct ctccggattt gatttactac cgcaatgccg agggggtgtt ctctggttgt       540
     aaccgagcga tggaagagtt gactggcaag aaagagcatc aattggtcgg cttaagccct       600
     tgggatgttt acagcaagga agttgctcaa caaattgtcg atacggatca gcaagttttt       660
     gccaataatc gcgctttgac ttacgagcag tggcttgaat acccagatgg tagaaaacac       720
     tactttgagc tgcgtaaagt gccgttttac agcaaagatg ggcgtcacct aggattggtt       780
     ggctttggcc gtgacattac agaacgtaag cgccatgaag aatcattgga aaaagcgagc       840
     cgcgataaaa ccacgttcat ttcaaccatc agtcacgagc ttagaacccc acttaacggc       900
     attgttggtt taagtcgtat gttattggat acgcgcttaa ccgatgagca gcgcaagtac       960
     atgcaaacca tcaatgtcag cgcgatcacc ttaggtaata tattcaatga catcatagat      1020
     atggacaagt ttgatcgccg caaattagag ctgttacccg ctccgcttaa ctttgaagat      1080
     tttgtcgcag aaatcgaaag catttcggca cttatggcag aacaaaaagg attgcgattt      1140
     gatttagagc gtctgagtga actgcctaaa gccatcgagg tggatgccac gcgcttgcgc      1200
     caagtcattt ggaatctcat cagcaatgcg atgaagttta ccaaagaggg tggagtggtc      1260
     atgacggtga gttccgaagt ggaagaggat tttgccacca tcattattga agtagaagat      1320
     acagggatcg ggattccaga agcggaactg gataagattt ttgccatgta ctaccaagtc      1380
     aaatcgggta aagataactt gcatgccgtt ggaaccggga ttggtttggc ggtttcacgc      1440
     cagttgatca acatgatgga cggcgatatt accgtcagca gtgaggaagg ctttggtagt      1500
     acgttcacta tttcgattca cgttcctgtg attgaatctg caccatcgac tgtggacaaa      1560
     ccgaaaaccc agctctatct cagtatcttt atggtggaag acattgcact caacgtcacc      1620
     gttgctcgct ctctacttga aagtctcggc cacaaagtga cggttgcgat gacaggggac      1680
     gaggcgatac gctcctttga cccgagccgc tacgatttgg tgttactgga tatccaactg      1740
     ccggatatga cggggtttga tgtcgctgcg tactatcgca aacactatag ccaattgcca      1800
     ccgctggttg ctctcactgc caacgtattg aaagataagc gagagtatct agacaatggc      1860
     atggatgaag ccattagcaa gccacttgcg gtacaggcaa ttcaagatgt gattgaaaaa      1920
     ctgatcatca aacaagaaag caccaccatc gagatggaag aggcagaagt tgttgagatc      1980
     acaaccagcc atgtagagaa tcatattttg gatctggtga tgcttgaatc ctacgtagag      2040
     attgttggac cgcagcccgt cctcgatagc attcgtatgt ttgaagagat gatgcctgaa      2100
     taccttgaaa tactcgattc caatatgatt gcaaaagatc aacctggaat tgtttccgaa      2160
     gcgcataaaa tcaagggggc ggcgggttcg atcgggttga aacgaattca aagcgttgcg      2220
     caaaaagcgc aatctccaga catgcccgca tggtgggaaa atatcgcgga ctgggtagaa      2280
     gaaatcaaga atgagtatca aaatgatatt cagatattga agagttggtt agaacagagg      2340
     tga                                                                    2343
//

If you have problems or comments...

PBIL Back to PBIL home page