(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0647

BA000037.VV0647      Location/Qualifiers
FT   CDS_pept        643224..643631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0647"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93411"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93411"
FT                   /db_xref="InterPro:IPR021710"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNR8"
FT                   /protein_id="BAC93411.1"
FT                   /translation="MINNGETTVDASLWHAYSASFFHFNDEWQSDRFAIITAWNPASIL
FT                   QSKKENCISNQKLKTKINTRRFCSVLVADKACCWSEESFAVEINLNYALNLAREFKQNA
FT                   IYFVEQGELFLVSCLSDERKESLGPFDQRIR"
     atgataaata atggtgaaac aactgtagat gcgtcattat ggcatgccta ttcagcctct        60
     tttttccatt ttaatgatga atggcaaagc gatcgttttg ccattattac agcatggaac       120
     cctgcgagta ttttgcagtc aaaaaaagag aattgcataa gtaatcagaa gttaaaaaca       180
     aagattaaca cgcgacgctt ttgttctgtt ttagtcgccg ataaggcgtg ctgctggagc       240
     gaagaaagtt ttgctgtcga gataaatttg aattacgcac taaacttagc aagagagttc       300
     aaacaaaacg cgatttattt tgttgaacaa ggagagcttt ttttagtgtc ttgcttgagt       360
     gatgaaagga aagaatcact ggggccgttt gaccagcgca tcagataa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page