(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0653

BA000037.VV0653      Location/Qualifiers
FT   CDS_pept        complement(649939..650319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0653"
FT                   /product="acid-induced glycyl radical enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93417"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93417"
FT                   /db_xref="GOA:Q7MNR2"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR011140"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNR2"
FT                   /protein_id="BAC93417.1"
FT                   /translation="MMIQGIQITKAANDDLLNSIWLLDSEKNEARCVAAVSGYEADQIV
FT                   AINELGEFESREVAIEAAPRIEGGQHLNVNVLKRETLEDAVAHPEKYPQLTIRVSGYAV
FT                   RFNSLTPEQQRDVIARTFTESL"
     gtgatgatcc aaggtatcca aattactaaa gcagcaaacg acgacctact aaactcaatc        60
     tggcttctag atagcgagaa aaatgaagct cgctgtgtag cggcagtttc tggctacgaa       120
     gccgatcaaa tcgttgcaat taacgagcta ggtgagtttg aaagccgtga agtggctatc       180
     gaagcagcac cacgcattga aggtggtcaa cacctaaacg tgaacgtttt aaaacgtgaa       240
     acgctagaag atgcagttgc gcacccagag aaatacccac agctaaccat ccgcgtatcg       300
     ggttatgctg tgcgtttcaa ctcactaaca ccagaacaac agcgtgacgt cattgctcgt       360
     acgtttactg aatctctata a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page