(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0666

BA000037.VV0666      Location/Qualifiers
FT   CDS_pept        661927..662721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0666"
FT                   /product="protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93430"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93430"
FT                   /db_xref="GOA:Q7MNP9"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNP9"
FT                   /protein_id="BAC93430.1"
FT                   /translation="MILMSVLRRLTLLTLPLFVTACGAEESQAVETAQPAAQVAASTHF
FT                   DSEALKARFSKLGLNIMDIQPSDVAGLVEIQTSGGVLFASKDGSHFIAGTLYSIDENGQ
FT                   YKDVIAERQAPLNAKKIAEFADSAIEYKAKDEKYVVTVFTDITCGYCVRLHSQMQGYND
FT                   LGITVRYMAYPRQGGTGPVAEQMAGIWCAANPQEAMHDAKVNRKFAPAKNDLQQCKQTV
FT                   AQHYQLGQQLGITGTPAIFLPNGELVAGYLPPEKLLERLQQP"
     gtgattttaa tgagcgtatt acgccgatta actcttttaa ctcttcctct ctttgtgacg        60
     gcctgcggtg ctgaagaaag ccaagcggtc gaaacagctc agccagcggc acaagtggcg       120
     gcgagcacgc attttgatag cgaggctctc aaagctcgtt tttccaagct gggcctgaac       180
     atcatggata ttcaaccttc ggatgtggcg ggtttagtcg aaattcaaac cagtggcggg       240
     gtgttatttg cgtctaaaga cggtagccac tttatcgctg gaaccttgta ttccatcgac       300
     gaaaatggtc aatacaagga cgtgatcgca gaacgccaag cgccgctcaa cgccaagaaa       360
     attgccgaat ttgctgacag cgcgatcgag tacaaagcca aagatgaaaa atacgtggtg       420
     acggtgttta ccgacattac ttgcggttac tgcgttcgtc tacacagcca gatgcagggc       480
     tacaatgact taggtatcac cgtgcgttac atggcatacc cacgccaagg tggcacgggc       540
     cctgtggcag aacaaatggc gggcatctgg tgtgccgcta atccgcaaga agcgatgcat       600
     gatgctaaag tgaaccgcaa atttgcccca gcgaaaaatg atttacagca gtgcaagcag       660
     accgtggctc aacattacca acttggtcag caactcggta ttacaggcac gcctgcgatt       720
     ttcttgccaa atggtgagct ggttgctggt tacttgccac cagaaaaact gctagaacgt       780
     ttacagcaac cataa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page