(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0690

BA000037.VV0690      Location/Qualifiers
FT   CDS_pept        689343..690305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0690"
FT                   /product="penicillin tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93454"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93454"
FT                   /db_xref="GOA:Q7MNM5"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNM5"
FT                   /protein_id="BAC93454.1"
FT                   /translation="MSNEMKILLANPRGFCAGVDRAISIVERALELYQPPIYVRHEVVH
FT                   NRFVVEGLKQRGAIFVEELHEVPDDNIVIFSAHGVSQAVRQEAKERALTVFDATCPLVT
FT                   KVHMEVARASRKHMEVVLIGHAGHPEVEGTMGQYASLQGGMYLVEKPEDVLGLKAIVKD
FT                   PSNLHYVSQTTLSVDETADVIDELRRVFPEIQGPRKDDICYATQNRQDAVRELAKDVDV
FT                   VVVVGSKNSSNSTRLKELAEKLGTPAYLTDCPQDIEPQWFDGKVKVGVTAGASAPEELV
FT                   NQILTRIKELGAQSVEEVLGREENMFFEVPKELQIKQID"
     atgagcaatg aaatgaaaat cttgttagcg aacccacgtg gattctgtgc gggtgtcgac        60
     cgtgccatca gtattgttga gcgtgcactg gagctgtatc aaccgcctat ctacgtacgc       120
     catgaagtgg tgcacaaccg ttttgtggtg gaaggcttaa agcagcgcgg cgcgatcttt       180
     gtcgaagagc tgcatgaagt gccagacgac aatattgtta ttttctctgc tcatggcgtg       240
     tctcaagcgg tgcgtcagga agccaaagag cgtgcgctaa ctgtgtttga tgcgacatgc       300
     ccattggtga cgaaagtgca tatggaagtg gcgagagcca gccgtaagca tatggaagtg       360
     gtgctgatcg gtcatgcggg ccacccagag gtagaaggta ccatgggtca atatgccagc       420
     ttgcagggtg gcatgtacct cgtcgaaaaa ccggaagatg tacttggctt gaaagccatt       480
     gttaaagatc cgagcaactt gcactacgta agccaaacga ccttatcggt ggatgaaacc       540
     gcggacgtga ttgatgagtt gcgtcgagtt ttcccagaga tccaaggccc acgcaaagac       600
     gatatctgct atgcgacaca aaaccgccaa gatgcggtgc gtgaattggc gaaagatgtc       660
     gacgtggtag tggtagtggg ttcaaagaac tcctcaaact cgacccgact aaaagagttg       720
     gcggaaaaac taggcacacc tgcttactta acagattgtc cgcaagacat tgagccacaa       780
     tggtttgatg gcaaagtcaa agtgggcgta acggcagggg cttctgcacc agaagaactg       840
     gtcaatcaaa tcctaactcg cattaaagag ttgggtgctc aatcggttga agaagtgcta       900
     ggccgtgaag agaacatgtt ctttgaagtg cctaaagagc tgcaaattaa gcagattgac       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page