(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0693

BA000037.VV0693      Location/Qualifiers
FT   CDS_pept        complement(692973..694457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0693"
FT                   /product="carbon starvation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93457"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93457"
FT                   /db_xref="GOA:Q7MNM2"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNM2"
FT                   /protein_id="BAC93457.1"
FT                   /translation="MMWFLTCVAALIGGYFIYGAFVEKVFGINENRRTPAHTKTDGVDY
FT                   VPMSTKKVYLVQLLNIAGVGPIFGPIMGALYGPAAMLWIVVGCIFAGAVHDYFSGMLSV
FT                   RNGGASVPTITGRYLGNGAKHFMNIFAIVLLLLVGVVFVSAPAGMITNLINDQTSFSVS
FT                   MTTMVVVIFAYYIIATIVPVDKIIGRFYPLFGALLIFMSVGLMTAIAFSSEHTVMGDFQ
FT                   VSDMFTNLNPNDMPLWPALFITIACGAISGFHATQSPLMARCMENEKNGRFVFYGAMIG
FT                   EGVIALIWCAIALSFFGTLEGLAEAVKNGGPGNVVYSASFGLLGVFGGVIAFLGVVILP
FT                   ITSGDTAFRSSRLILAEYFNMEQKTLRNRLLMAVPLFVLGGILTQVDFGIIWRYFGFAN
FT                   QTTAVMMLWTASAYLLRHNKLHWITTVPAFFMTTVCVTFILNNSALGFGLPMQLSTIAG
FT                   VLFAAAVTGYVIKTSKGKGETDLADEEKPQGVTETA"
     atgatgtggt ttcttacctg tgtcgcagcc ctgattggcg gatacttcat ctacggtgct        60
     ttcgttgaga aagtatttgg tatcaatgaa aatcgccgta cccctgccca tacaaaaacc       120
     gacggcgttg actatgtgcc aatgtcgacc aaaaaagtct acttagtgca actccttaac       180
     attgctggcg ttggccctat ctttggtcca atcatgggtg ctctatacgg ccctgcggcg       240
     atgctttgga ttgttgtcgg ctgtatcttc gctggtgcag tacacgatta cttctctggc       300
     atgctttctg tgcgtaacgg tggtgcttca gtaccgacta tcacaggtcg ctacctcggc       360
     aatggcgcga aacactttat gaacattttt gccattgtct tgctgctgct tgttggtgtg       420
     gtcttcgttt ccgcgcctgc tggcatgatc accaatctga tcaatgacca aaccagcttc       480
     tctgtgagca tgaccaccat ggttgtggtg atttttgctt actacatcat cgcgaccatc       540
     gtaccagttg ataaaatcat cggtcgcttc tacccactgt ttggtgcgtt gctgattttc       600
     atgtctgttg gtctgatgac ggcgattgca ttctcttctg agcacacggt gatgggtgat       660
     ttccaagtca gcgacatgtt cactaactta aacccgaatg atatgcctct atggcctgct       720
     ttgttcatca ctattgcctg tggtgcgatc tctggcttcc acgcaacgca atcacctttg       780
     atggctcgtt gtatggaaaa tgagaaaaac ggccgctttg tcttctacgg tgcaatgatt       840
     ggtgaaggtg tgatcgcatt gatctggtgt gctatcgcac tctcgttctt cggcacactt       900
     gaaggactcg cagaagcggt gaaaaacggt ggccctggca acgtggttta cagcgcatca       960
     tttggtctgc ttggcgtatt tggcggcgta attgccttcc taggtgtggt cattcttcct      1020
     attacttcgg gtgacacagc gttccgctct agccgtttga tccttgctga atacttcaac      1080
     atggaacaga aaaccctacg taaccgcctg ttgatggccg taccactgtt cgtacttggt      1140
     ggcattctga ctcaagtcga tttcggcatc atctggcgct acttcggttt tgccaaccaa      1200
     accaccgcag tcatgatgtt gtggaccgca tcagcttacc tactgcgtca caacaagcta      1260
     cattggatca ccacagtacc tgctttcttc atgacaacag tttgtgtgac ctttatcctc      1320
     aacaacagcg cgttgggctt tggtttgcca atgcaactct ccaccattgc tggcgtactc      1380
     ttcgcggcag cggtaaccgg ttacgtgatt aaaacatcaa aaggcaaagg cgaaacggac      1440
     cttgccgatg aggaaaaacc tcaaggcgtc actgaaaccg cttaa                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page