(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0694

BA000037.VV0694      Location/Qualifiers
FT   CDS_pept        694493..694684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0694"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93458"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93458"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNM1"
FT                   /protein_id="BAC93458.1"
FT                   /translation="MDSKAWFGEMHSVMKSVVEYRVEWSMGQLSGFNVCSMVGTELFFV
FT                   HERHIRCFDDNVFAQTIS"
     atggatagta aagcgtggtt tggcgagatg cattcggtga tgaagtcagt ggtcgaatat        60
     cgagttgagt ggtcgatggg ccaattaagt ggttttaacg tttgctcaat ggtcggaaca       120
     gaactatttt ttgtgcacga gcggcatatt cgctgttttg atgataatgt atttgcacaa       180
     acaatcagtt aa                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page