(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0704

BA000037.VV0704      Location/Qualifiers
FT   CDS_pept        complement(702616..702990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0704"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93468"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93468"
FT                   /db_xref="GOA:Q7MNL1"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR027021"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNL1"
FT                   /protein_id="BAC93468.1"
FT                   /translation="MAERRRFSRIMYQVPAIVKQGQYVLHTTIQDLSLHGLLLRTDSMH
FT                   TLRNNDTVLVDFTLSDSDIDISLEADVVGFDQQTIRLKITHIDIDSISHLKRLVELNVG
FT                   DDALLHREIEHLSDLGDEAS"
     atggctgaac gacgtcgatt ttcacgcatc atgtatcaag tccctgcgat agtgaaacag        60
     gggcaatatg tgttgcatac tacgattcag gatctctcac tgcacgggct gttgttacgt       120
     actgattcaa tgcatacgtt aaggaacaac gacactgtgt tggtggactt cacactttct       180
     gatagtgata ttgatatcag tctcgaagca gatgttgtgg gctttgatca acagacaatt       240
     agacttaaaa ttacccacat tgatatagat agtatcagtc atttaaaacg cttggttgaa       300
     ctaaatgtgg gtgatgacgc gctgcttcat cgagaaatag aacatttgtc tgatctcggt       360
     gacgaagcaa gttag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page