(data stored in ACNUC7421 zone)

HOGENOMDNA: BACA1_1

ID   BACA1_1; SV 1; empty ; DNA; empty ; PRO; 4168266 BP.
XX
AC   NC_014639;
XX
PR   Project: 59887;
XX
DE   Bacillus atrophaeus 1942 chromosome, complete genome.
XX
OS   Bacillus atrophaeus 1942
OC   Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-4168266
RG   Transformational Medical Technologies Program
RA   Gibbons,H.S., Broomall,S., McNew,L.A., Daligault,H., Chapman,C., Bruce,D.,
RA   Karavis,M., McGregor,P., Hong,C., Park,K.H., Akmal,A., Feldman,A.,
RA   Lin,J.S., Chang,W.E., Higgs,B.W., Demirev,P., Lindquist,J., Liem,A.,
RA   Fochler,E., Tapia,R., Bishop-Lilly,K., Detter,C., Han,C., Sozhamannan,S.,
RA   Rosenzweig,C.N. and Skowronski,E.;
RT   "Genomic signatures of strain selection and enhancement in Bacillus
RT   atrophaeus subsp. Globigii, a historical biowarfare simulant";
RL   Unpublished
XX
RN   [2]
RP   1-4168266
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (02-NOV-2010) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-4168266
RG   Transformational Medical Technologies Program
RA   Gibbons,H.S., Broomall,S., McNew,L.A., Karavis,M., McGregor,P., Liem,A.,
RA   Fochler,E., Donarum,G., Rosenzweig,C.N. and Skowronski,E.;
RT   "Direct Submission";
RL   Submitted (13-SEP-2010) Genomics Integrated Product Team, US Army Edgewood
RL   Chemical Biological Center, 5183 Blackhawk Rd, Aberdeen Proving Ground, MD
RL   21010-5424, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP002207.
CC   Source DNA available from Henry S. Gibbons.
CC   Annotation was added by the NCBI Prokaryotic Genomes Automatic
CC   Annotation Pipeline Group. Information about the Pipeline can be
CC   found here:
CC   http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html. Please be
CC   aware that the annotation is done automatically with little or no
CC   manual curation.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..4168266
FT                   /strain="1942"
FT                   /mol_type="genomic DNA"
FT                   /organism="Bacillus atrophaeus 1942"
FT                   /db_xref="taxon:720555"
FT   gene            join(4168122..4168266,1..236)
FT                   /db_xref="GeneID:9894251"
FT                   /locus_tag="BATR1942_21160"
FT   CDS_pept        join(4168122..4168266,1..236)
FT                   /locus_tag="BATR1942_21160"
FT                   /gene_family="HOG000267563" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066969"
FT                   /db_xref="GeneID:9894251"
FT                   /translation="MNLNFIVPDINMTFGDMKFMGLNKERYVYDRENNKRTDVLESRVY
FT                   NIASAVQGGQIEVTIPEYAGAKEIPPFADIELKNPKISAIATSQRDSTFANVMWKLEAD
FT                   DIVVKGGSSVKPAAATGGNDKK"
FT                   /protein_id="YP_003971892.1"
FT   gene            complement(277..837)
FT                   /db_xref="GeneID:9894250"
FT                   /locus_tag="BATR1942_00010"
FT   CDS_pept        complement(277..837)
FT                   /locus_tag="BATR1942_00010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066970"
FT                   /db_xref="GeneID:9894250"
FT                   /translation="MFDKLMGLYFKFSTYLTYLLLFSIILASFHPQVFTHFFNAIVKFI
FT                   PVSIINYLTEKNINRTDVFYIFTIVSAISGIGVIWNFFYPRYYIRKMIELGLDRKQYPS
FT                   FHMASIHNKSSELTTLFLLSITLFMQTSVTSFSQFKSLVLNLLHNAPFVFLFCCIGTAG
FT                   SIFNILIFTMSGFGTTIEKKDKP"
FT                   /protein_id="YP_003971893.1"
FT   gene            1272..2636
FT                   /db_xref="GeneID:9889970"
FT                   /locus_tag="BATR1942_00015"
FT   CDS_pept        1272..2636
FT                   /locus_tag="BATR1942_00015"
FT                   /gene_family="HOG000264154" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative DNA wielding protein; mobile element
FT                   region"
FT                   /transl_table="11"
FT                   /note="COG1674 DNA segregation ATPase FtsK/SpoIIIE and
FT                   related proteins"
FT                   /db_xref="GI:311066971"
FT                   /db_xref="GeneID:9889970"
FT                   /translation="MRNNVKLAGAIIFVPVFLLSMIIFWREQLIHFDLNRVIKHFEWNV
FT                   PLIIKSVLCSLLIAVGSIVASYFLFFDSYKKILHRQKIAKMIFSNKFYERDNVKVRKLF
FT                   SNETDTKEKITYFPRMYYQVKNNHIYIRIAMDMSRFQNRFLDLGKDLENGLFCDLVDKQ
FT                   MEEGFVCFKLLYDVKKNRISIDDAKTEKGVLPLMKHISWQFDKLPHMLIAGGTGGGKTY
FT                   FMLTIIKACVGLGTDVRILDPKNADLADLEEVLPKKVYSQKNGILMCLRKSVDGMMERM
FT                   DEMKQMPNYKTGENYAYLGLKPVFIFFDEYVAFMDLLDMKERNEALSYMKQLVMLGRQA
FT                   GYFLVLGAQRPDAKYLADGIRDQFSFRVSLGLMSETGYGMMFGDVDKAFVNKKETGRGY
FT                   ANVGTGSVLEFYSPIVPKGYDFMSSIKNALAGVEGAQATAVASGSVSDQTASAKE"
FT                   /protein_id="YP_003971894.1"
FT   gene            2646..3704
FT                   /db_xref="GeneID:9889971"
FT                   /locus_tag="BATR1942_00020"
FT   CDS_pept        2646..3704
FT                   /locus_tag="BATR1942_00020"
FT                   /gene_family="HOG000267561" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative replication protein; mobile element
FT                   region"
FT                   /transl_table="11"
FT                   /note="COG2946 Putative phage replication protein RstA"
FT                   /db_xref="GI:311066972"
FT                   /db_xref="GeneID:9889971"
FT                   /translation="MDELKQPPHANRGVVIVKEKNETVESPLVSIVDYIRVSFKTHDVD
FT                   RIIEEVLHLSKDFMTEKQSGFYGYVGTYELDYIKVFYSAPDDNRGVLIEMSGQGCRQFE
FT                   SFLDCRKKTWYDFFQDCMQQGGSFTRFDLAIDDKKTYFSIPELLKKAQKGECISRFRKS
FT                   DFNGSFDLSDGITGGTTIYFGSKKSEAYLCFYEKNYEQAEKYNIPLEELGDWNRYELRL
FT                   KNERAQVAIDALLKTKDLTLIAMQIINNYVRFVDADENITREHWKTSLFWSDFIGDVGR
FT                   LPLYVKPQKDFYQKSRNWLRNSCAPTMKMVLEADEHLGKTDLSDMIAEAELADKHKKML
FT                   DVYMADVADMVV"
FT                   /protein_id="YP_003971895.1"
FT   gene            3968..4240
FT                   /db_xref="GeneID:9889972"
FT                   /locus_tag="BATR1942_00025"
FT   CDS_pept        3968..4240
FT                   /locus_tag="BATR1942_00025"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066973"
FT                   /db_xref="GeneID:9889972"
FT                   /translation="MGIAPIDFATSTGGKYDDPMRVFLIVLDEHVFILNAFSLEDINNF
FT                   LKKEFPENIEKPFAIMELTNYQLKILDKPYIEKLVDDCRELFNTR"
FT                   /protein_id="YP_003971896.1"
FT   gene            complement(4227..4793)
FT                   /db_xref="GeneID:9889973"
FT                   /locus_tag="BATR1942_00030"
FT   CDS_pept        complement(4227..4793)
FT                   /locus_tag="BATR1942_00030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066974"
FT                   /db_xref="GeneID:9889973"
FT                   /translation="MSNLSEYTLVFKPHSPSFIESNDDYLTKRDVKTNHNQISLTNKEV
FT                   RSLAQLIDIKNTESDNKLNSVVEINKNMKLTLNELFYSLDSPNEIKFELRVYYGKAQFI
FT                   NENGHDVIKFATEQHHKNHLNEIVTDTPSIKVFSSSLNKFKHLKDLVSYLNTDKTFTCY
FT                   YFGFPTLDRFIRFIPYFYNNLFIEY"
FT                   /protein_id="YP_003971897.1"
FT   gene            complement(4867..5043)
FT                   /db_xref="GeneID:9889974"
FT                   /locus_tag="BATR1942_00035"
FT   CDS_pept        complement(4867..5043)
FT                   /locus_tag="BATR1942_00035"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066975"
FT                   /db_xref="GeneID:9889974"
FT                   /translation="MKIRVIGILVGVILFITGILLPEAKFDYPQCISFAGAFIASTSIG
FT                   SLMNLKKQSATNS"
FT                   /protein_id="YP_003971898.1"
FT   gene            5123..5389
FT                   /db_xref="GeneID:9889975"
FT                   /locus_tag="BATR1942_00040"
FT   CDS_pept        5123..5389
FT                   /locus_tag="BATR1942_00040"
FT                   /gene_family="HOG000155519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG0495 Leucyl-tRNA synthetase"
FT                   /db_xref="GI:311066976"
FT                   /db_xref="GeneID:9889975"
FT                   /translation="MFDINLLNKARLESDLESLGCLEIAEELIEKMMEDVFYSDVAQRV
FT                   IVQTLTVIDNVNAKLQATFNILEDEDTETDERNVEFEGINYFM"
FT                   /protein_id="YP_003971899.1"
FT   gene            complement(5412..5519)
FT                   /db_xref="GeneID:9889976"
FT                   /locus_tag="BATR1942_00045"
FT   CDS_pept        complement(5412..5519)
FT                   /locus_tag="BATR1942_00045"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066977"
FT                   /db_xref="GeneID:9889976"
FT                   /translation="MGALFLHLKPDEYLKKLYKTKKLVEKHRFLYKLSI"
FT                   /protein_id="YP_003971900.1"
FT   gene            5701..6459
FT                   /db_xref="GeneID:9889977"
FT                   /locus_tag="BATR1942_00050"
FT   CDS_pept        5701..6459
FT                   /locus_tag="BATR1942_00050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066978"
FT                   /db_xref="GeneID:9889977"
FT                   /translation="MDNERLEEDFKKIILLKGIRNEKKYIEDAKNEKLYFTNAEVFRKM
FT                   GREHKEDLFGDALEGYYIRPSKEKKNFLNIKKGQKDAYDKEYLAKIYTCMKEVYISSFF
FT                   YIKIEEFKNNKIPESIINVFRNEFSDRKIAVFYGVQNLLDGLKRKYPNSFSWANYVLYQ
FT                   GIDEEPIYAEEAYDKDPRKGYRLKRKGLYENQREFRICFHKSSFSDKFIEENKNGFNLS
FT                   YGYIGEGNISSVTILDDINDLKHITIEEKK"
FT                   /protein_id="YP_003971901.1"
FT   gene            complement(6800..6988)
FT                   /db_xref="GeneID:9889978"
FT                   /locus_tag="BATR1942_00055"
FT   CDS_pept        complement(6800..6988)
FT                   /locus_tag="BATR1942_00055"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066979"
FT                   /db_xref="GeneID:9889978"
FT                   /translation="MIKNLPILAALCSVGVSLVTISRVIELSVTFNWIVLLLGVAMTFY
FT                   SAVCLVAKAMQLKETTN"
FT                   /protein_id="YP_003971902.1"
FT   gene            7083..7361
FT                   /db_xref="GeneID:9889979"
FT                   /locus_tag="BATR1942_00060"
FT   CDS_pept        7083..7361
FT                   /locus_tag="BATR1942_00060"
FT                   /gene_family="HOG000011012" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066980"
FT                   /db_xref="GeneID:9889979"
FT                   /translation="MSAVDKRFKSLGFNVGIPSLVFVRSLSRDCMLVVEGERVKGFAEY
FT                   RYSFYKTRYLPDGRMTSLKVYMENQSIKRVLHRVASFLLFLEKTKQV"
FT                   /protein_id="YP_003971903.1"
FT   gene            7379..7528
FT                   /db_xref="GeneID:9889980"
FT                   /locus_tag="BATR1942_00065"
FT   CDS_pept        7379..7528
FT                   /locus_tag="BATR1942_00065"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066981"
FT                   /db_xref="GeneID:9889980"
FT                   /translation="MKQSVEVVEIKGKPVEVIVTELNEPNYEKMARAILKMTRNMKVNQ
FT                   EESA"
FT                   /protein_id="YP_003971904.1"
FT   gene            7556..8620
FT                   /db_xref="GeneID:9889981"
FT                   /locus_tag="BATR1942_00070"
FT   CDS_pept        7556..8620
FT                   /locus_tag="BATR1942_00070"
FT                   /gene_family="HOG000011015" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066982"
FT                   /db_xref="GeneID:9889981"
FT                   /translation="MLQKEIDLDKKEESFFRSAFQKLKRIERPEKDKQKVPRDRSKLIA
FT                   VTLWSCVGGLLFICLLVVLLSINTRSQLNDMKEEANKPTNDDKQKISVTAAENFLSGFI
FT                   NEYVNVKNNQESIEKRMQSLESYMVKQEDNHFEDEERFNVDGLKGDRELKDYSLYNVKE
FT                   GDKNSLFQYKVTYENLYPVEKEVEKEVKDGKKKKKVKEKVKTNEKSENQMLLNIPVTNK
FT                   GDSFAVSAVPYFTQIYDLKGDIASKGNEETRDEYAGEKKESIETFLHTFFEKYASEKKE
FT                   EMVYMMKKPEALEGNLLFGEVQSMKIFEMKKGFEVFCAVRFKEKENDIPVNEKFSLEIT
FT                   ENSGQFYVNKLKHQ"
FT                   /protein_id="YP_003971905.1"
FT   gene            8632..8880
FT                   /db_xref="GeneID:9889982"
FT                   /locus_tag="BATR1942_00075"
FT   CDS_pept        8632..8880
FT                   /locus_tag="BATR1942_00075"
FT                   /gene_family="HOG000011016" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066983"
FT                   /db_xref="GeneID:9889982"
FT                   /translation="MDFMNFFILGADLPTLGGVKGWASDVVIQFITIVVMFIAAKNLMK
FT                   LKMGGIIFVCCIGSAVTWVIKHWSEFSGWINALMEKL"
FT                   /protein_id="YP_003971906.1"
FT   gene            8893..9417
FT                   /db_xref="GeneID:9889983"
FT                   /locus_tag="BATR1942_00080"
FT   CDS_pept        8893..9417
FT                   /locus_tag="BATR1942_00080"
FT                   /gene_family="HOG000011017" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066984"
FT                   /db_xref="GeneID:9889983"
FT                   /translation="MGRLVFNYRKAMREPKKIQQLTENYSLPFAVELIPAINYFIFVGL
FT                   CFGFWYGVRMIFPHAFDNSYVIVIFGIPFFLTMLVTKIKPEGKNIYLYFFDFAKYYFFI
FT                   KLPQKKYCNDRKVDLSNEKQIEFRKLVKVVDYSNETKNAYEGNTREFTVNKNGRRVGVL
FT                   PNKKQFDSYAK"
FT                   /protein_id="YP_003971907.1"
FT   gene            9407..11800
FT                   /db_xref="GeneID:9889984"
FT                   /locus_tag="BATR1942_00085"
FT   CDS_pept        9407..11800
FT                   /locus_tag="BATR1942_00085"
FT                   /gene_family="HOG000011018" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG3451 Type IV secretory pathway, VirB4 components"
FT                   /db_xref="GI:311066985"
FT                   /db_xref="GeneID:9889984"
FT                   /translation="MQNREKVESYKKKWQHLFEEITSYEDFHLMMYPSEYELEKRFKDL
FT                   ETDIAADAMDVARYYNEETVRLLEQRLGRLTKYDFILGVKLKSSLVNISVELKDNILSF
FT                   FNTATDTVVKMLGWEQNVSTSFFEKYEEVEETLANIMASVRGERLSESEMTYINRYHFV
FT                   RGLNHQTNEESEIKDVRSITNTIIDLADPSVLHLHSDQDEGYSAFIVIDEFLHNMSESD
FT                   VFYEAQSLPFPVEVQMKIQTEPKSITKPALNLKRQQLKEEQKEQQSTGDRSDVSTVTSA
FT                   TMIRHLQDEIKKEDVHVMNWLAVVVVHGKTKKECVGKAKIVKRHLKGAGITCRLPVADQ
FT                   LNLFYKMLPGEKLDITDKNWIQKTTQDGVAEGLFAVNSDIGSKIGFFLGWVDRFQEHTD
FT                   LESAIMSSRDFVLFHPFLANQYLKGSKTRSPHCLITGDTGNGKSYLAKLMFIYVSMLNI
FT                   KSLYIDPKKEMRKWIQKVLNDEYIRENFPLYIAHLEQYNYITLDHENTHNWGALDPVSF
FT                   LPPMKAKELVQVIFEQVYDFKGKDDINTAFLRATSEVIDAKQKGEQVGSLDIIRKMQSH
FT                   PEKSVQKAGDYLNEVVSDSNLKLCIHDGSNPALSLEKRITILEVENMDLPDHGERLENY
FT                   TISQLKSSAVMFALGKFCELFGMNPDEQTVEFIDEAWIFTTSQQGKKVERQMRRIGRSY
FT                   NNAEYFISQSTKDALKEEDSGNFGVAFAFDEPNEREEVLKWMNMEVTKENKKMMESMFQ
FT                   GQCLFKDYYGRTSKISIECLFEEWQGALKTVEKKAVAYAEEKYL"
FT                   /protein_id="YP_003971908.1"
FT   gene            11818..12033
FT                   /db_xref="GeneID:9889985"
FT                   /locus_tag="BATR1942_00090"
FT   CDS_pept        11818..12033
FT                   /locus_tag="BATR1942_00090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066986"
FT                   /db_xref="GeneID:9889985"
FT                   /translation="MEIAFLNSLVVTSPGFYKAEKITLDEVKQWLNHYDGRYKSFIGHK
FT                   STAQFLQKLLGIRIEQNRKTFRHMKY"
FT                   /protein_id="YP_003971909.1"
FT   gene            12157..14592
FT                   /db_xref="GeneID:9889986"
FT                   /locus_tag="BATR1942_00095"
FT   CDS_pept        12157..14592
FT                   /locus_tag="BATR1942_00095"
FT                   /gene_family="HOG000011019" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066987"
FT                   /db_xref="GeneID:9889986"
FT                   /translation="MKKKRILIVSAIVLLFLTVASAVTVFSADGDTTTQPKVEKAGGVE
FT                   LKVKRFPISRYQANNEASDDLIKGAFVGLTNVTFSFAGNIVRVVDAGMDILYNLQPIDE
FT                   FANSITNVSKSVYKTLKKNFGEALFIFTCGYVVYLFCVRGSAKEAMRRSILFICVMVIG
FT                   GLWMSNAGYYMKALNALSVEAQGKLLTAGNGLVGIVQDEGNFADSSAIEKGKEIEGTVA
FT                   VMRNLYFDMALMKPFLIVNFGETSEAKINEKGDSKSKLSRVDKLLSYKLSKEGEKEKLD
FT                   YIESVEIKKYENESMTAGSAFTQLGESFIAVVSSIVIGIPFLALAFFNFLLQIIALVIV
FT                   FFVPFAFILAYVPQLAYSGFVTLGRLGSVYLLKAMLGVIVLFVYVICFMVDTLIPPNGF
FT                   GKYLLNVTVLALILWIGFVKRDAIIKFVTAGKVVSVDNNMLENMRQNVVQPAWENAKKI
FT                   GGTLGNGGCVFTDFAKNFRGRKDGSADSVDGAPSGSGGNAPSGAAMGYDNTHAISRTPQ
FT                   KETANGIASHNSRSLKRNPQTLSKEQENQKEAFANAKENKQQSHLDRLRKDGINSPMLK
FT                   DALNVGNEDLPKRAPILQDKKDESARTDQKEYVEQLLKQPDNQQQIDDASLQHEEETIS
FT                   NRAPVLQENEKDTERTDQKAYVYEEQNQNPEIDQQQDFEIQKDDSVSKSEPVAQEKIAE
FT                   IIRSDQKVMTKQPEPQLSFESPQSTKVENQPIANNERKIRPSEPAKVLSDGIRVEKKQT
FT                   DALAESKAALRERQSSAQTIKRTEQNINTLEQVSLSDITRRTSSKVEDRLRRDERTTL"
FT                   /protein_id="YP_003971910.1"
FT   gene            complement(14626..15219)
FT                   /db_xref="GeneID:9889987"
FT                   /locus_tag="BATR1942_00100"
FT   CDS_pept        complement(14626..15219)
FT                   /locus_tag="BATR1942_00100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066988"
FT                   /db_xref="GeneID:9889987"
FT                   /translation="MTFDIETYSDLDDSKTIYITNFANVIPPEDIQMLKNELSESDITV
FT                   KSTDTEGQPMAFAELDTVVSILIHSAVLTSLVESIGQSATWDLIKLFASKSWQRIKGQK
FT                   YTKLYLSGGSERKDITFGINANINNADYTFRFDNVSPDDANEALDKILDFFKEQTNHQK
FT                   WSTHIGNYNNDKQEWELKELREIVKELNKNKIDK"
FT                   /protein_id="YP_003971911.1"
FT   gene            15327..16289
FT                   /db_xref="GeneID:9889988"
FT                   /locus_tag="BATR1942_00105"
FT   CDS_pept        15327..16289
FT                   /locus_tag="BATR1942_00105"
FT                   /gene_family="HOG000267549" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative cell wall hydrolase; mobile element
FT                   region"
FT                   /transl_table="11"
FT                   /note="COG0741 Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /db_xref="GI:311066989"
FT                   /db_xref="GeneID:9889988"
FT                   /translation="MVFSAPFIFFFVLSIVVVMTISRENQVGDDYIGGGDGEYETVGIA
FT                   PEVERFRAVFEKYARQEGVFDQVNIIMALTMQESGGRSLDIMQSSESIGLPPNSITDPE
FT                   YSIEVGIKYFKKVFKQAGGDVRLTIQAYNFGSGFIDYVKKNGGKFTKKLALDFSRLQAF
FT                   KMGWKSYGDPSYVDHVMRYVKGSDKNVAPVNGSMDFYETVMKEALKYEGQPYAWGGSNP
FT                   KTGFDCSGLVQWSFAKAGITLPRTAQEQHGATKKISEKEATAGDLVFFGGTYEGKAITH
FT                   VGIYVGNGRMFNSNDSGIEYSDLKSGYWREHLVSFGRIK"
FT                   /protein_id="YP_003971912.1"
FT   gene            16304..16807
FT                   /db_xref="GeneID:9889989"
FT                   /locus_tag="BATR1942_00110"
FT   CDS_pept        16304..16807
FT                   /locus_tag="BATR1942_00110"
FT                   /gene_family="HOG000011020" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066990"
FT                   /db_xref="GeneID:9889989"
FT                   /translation="MKTHIAWISACLLLVMLTGFFTNGQQTYKIEKLKDKNEVLTEKIK
FT                   ELNHIESTSSASENKAFFEAFFNYSDIDQRYETVKKHTTEKGFDYAFPSRSDQKHTVSV
FT                   QSELLSLESYSKPLDESHELFLNVVEIATTANSVTTNQVLIVQTTMKKEKDGWLVDNVQ
FT                   VKGN"
FT                   /protein_id="YP_003971913.1"
FT   gene            16872..17255
FT                   /db_xref="GeneID:9889990"
FT                   /locus_tag="BATR1942_00115"
FT   CDS_pept        16872..17255
FT                   /locus_tag="BATR1942_00115"
FT                   /gene_family="HOG000008756" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative lipoprotein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066991"
FT                   /db_xref="GeneID:9889990"
FT                   /translation="MKNLCIFLSLIMMIVLTACGGNKYDDAIDKVIGLEKKKDKEYGFD
FT                   TDGMERENAIVRVFDGGKYIQLGFYTDNPNREIAPYSYYEKIGDSYKELDHMPGNGEND
FT                   RLGLSKKIPDYEEAKGEETKLEE"
FT                   /protein_id="YP_003971914.1"
FT   gene            17473..18591
FT                   /db_xref="GeneID:9889991"
FT                   /locus_tag="BATR1942_00120"
FT   CDS_pept        17473..18591
FT                   /locus_tag="BATR1942_00120"
FT                   /gene_family="HOG000080281" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066992"
FT                   /db_xref="GeneID:9889991"
FT                   /translation="MKYSISPTSKDSAFGEDIILREKSTTRLLFRPQIINNKHNEEASV
FT                   KGCFIFQKKRSSENWEDHKELDLNKLKATEWVKLEIKSEEMLKLITELDMYYKIHKEYG
FT                   IEPGGRNYLKINNPRLEKIISLFKEDNSLFEALLDEDTEQLLKQTVKWMVRTKNSEEII
FT                   SRLLEVQENELDQLNNLIGITNIKKLLSVWEANKDNVDEEFWQKIFKDNAWVLSQVFAS
FT                   PLLLFDEKAYIGGKGLGNKGGKVVDFIFQNDISKDVALIEIKTPNTKILSGEYRQGAYS
FT                   IHSDLTGAIVQVLAYKEQLQREYGSLLLNSESDFKVFNPICVVIAGKLDELDKTRLQSF
FT                   ELYRKEMKNILIITFDELFKKVSLLLQLLSDK"
FT                   /protein_id="YP_003971915.1"
FT   gene            18851..20026
FT                   /db_xref="GeneID:9889992"
FT                   /locus_tag="BATR1942_00125"
FT   CDS_pept        18851..20026
FT                   /locus_tag="BATR1942_00125"
FT                   /gene_family="HOG000246974" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="response regulator aspartate phosphatase; mobile
FT                   element region"
FT                   /transl_table="11"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="GI:311066993"
FT                   /db_xref="GeneID:9889992"
FT                   /translation="MRPILLDKTKIPYDLVTKKLNAWYTSIKNDQVEKAERIKKEVETE
FT                   LVNMEENQDALLYYQLLEFRHEIMLSYMESKKIDDLNSSYETIKEIEEQGQLTGMLEYY
FT                   YFFFLGMYEFRRKELTSAISAYRIAETKLYQVEDEIERAEFFFKVSYVYYYMKQTYFSM
FT                   NYANRALKIFKNYDEYAVQTLRCQFIVAGNLIDSLEFEMALQQFLKALDIAEDIKIDHL
FT                   IGMSHMNIGICYEELKDYDNAANHLDLSIKIFEKSEHSFLTKALFAMAHVEAKRNNFNV
FT                   AQEYYLQGKEVAEKNKDKEYTAKFKILEGLYFANGEYHLINEAFSYLADRKMFADVENF
FT                   ATEIGHYFHHRGNLELSNEYYRISIEARRRIKKGEIINEDQPNSIDSNGIQ"
FT                   /protein_id="YP_003971916.1"
FT   gene            20568..20945
FT                   /db_xref="GeneID:9889993"
FT                   /locus_tag="BATR1942_00130"
FT   CDS_pept        20568..20945
FT                   /locus_tag="BATR1942_00130"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG1724 Predicted periplasmic or secreted
FT                   lipoprotein"
FT                   /db_xref="GI:311066994"
FT                   /db_xref="GeneID:9889993"
FT                   /translation="MKKLSMFLLSFTILFAGLFAATESASATKYIKVGNKKFSVTPTLK
FT                   ELGIKKPKVMKAEMPWGTGAASAKQVIKFLKSKGFSVVSQKGSHVKLKNSKGKTTIVPS
FT                   HGNKSLAKGTLNSILKQAGIK"
FT                   /protein_id="YP_003971917.1"
FT   gene            20962..21138
FT                   /db_xref="GeneID:9889994"
FT                   /locus_tag="BATR1942_00135"
FT   CDS_pept        20962..21138
FT                   /locus_tag="BATR1942_00135"
FT                   /gene_family="HOG000052915" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311066995"
FT                   /db_xref="GeneID:9889994"
FT                   /translation="MKQSGVKIEGVIYSLEGDLGHNKFLDEFLEFIESKGWQFGGGSFQ
FT                   VDEEGKHIDDIDD"
FT                   /protein_id="YP_003971918.1"
FT   gene            complement(21571..22599)
FT                   /db_xref="GeneID:9889995"
FT                   /locus_tag="BATR1942_00140"
FT   CDS_pept        complement(21571..22599)
FT                   /locus_tag="BATR1942_00140"
FT                   /gene_family="HOG000092767" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="fatty acid desaturase"
FT                   /transl_table="11"
FT                   /note="COG3239 Fatty acid desaturase"
FT                   /db_xref="GI:311066996"
FT                   /db_xref="GeneID:9889995"
FT                   /translation="MKEQNLRTLRKLVTPYEKSDLQKSICQIINTLVPFFLLWCLAYKS
FT                   LSISYFLTLAISVVAAGFLVRTFIIFHDCCHYSFFKNRKANRILGTITGILTLHPFDHW
FT                   AHDHSVHHATSSNLDKRGTGDIWVLTVEEYKEASTKTKIMYRLYRNPFVMFIVGPIYVF
FT                   GITNRFNRKGAKRKERMNTYVTNLGIVALAALLCWAIGWQNFLLVQVPTFMISGSLGIW
FT                   MFYIQHTFEDSYFEENEHWEYVKAAVEGSSFYKLPKVMQWLTGNIGFHHVHHLSPRVPN
FT                   YKLEKVHNNTEPLQNVPTITLAASLKSLKFRLWDEEGKKFVGFSHIKKASKSQISAGLR
FT                   TD"
FT                   /protein_id="YP_003971919.1"
FT   gene            23432..23635
FT                   /db_xref="GeneID:9889996"
FT                   /locus_tag="BATR1942_00145"
FT   CDS_pept        23432..23635
FT                   /locus_tag="BATR1942_00145"
FT                   /gene_family="HOG000070674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cold-shock protein"
FT                   /transl_table="11"
FT                   /note="COG1278 Cold shock proteins"
FT                   /db_xref="GI:311066997"
FT                   /db_xref="GeneID:9889996"
FT                   /translation="MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQSDGFKSLDEGQ
FT                   KVTFDVEQGARGAQAANVQKAA"
FT                   /protein_id="YP_003971920.1"
FT   gene            complement(24497..24958)
FT                   /db_xref="GeneID:9889997"
FT                   /locus_tag="BATR1942_00150"
FT   CDS_pept        complement(24497..24958)
FT                   /locus_tag="BATR1942_00150"
FT                   /gene_family="HOG000239163" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG1329 Transcriptional regulators, similar to M.
FT                   xanthus CarD"
FT                   /db_xref="GI:311066998"
FT                   /db_xref="GeneID:9889997"
FT                   /translation="MFQIGDNIVYPMHGAGIIEAIEEKEYSEEKQQYYVIKMSISNMQV
FT                   MIPTRKILSSSIRPVTDILALKHIIHIFQHGESDRLLPWKQRYKVNTNKIKTGEIQEGA
FT                   EVVRDLMRMKKEKALNSSEKKMLDNAYEFLISELEVIKGITENQIKSFC"
FT                   /protein_id="YP_003971921.1"
FT   gene            25607..26266
FT                   /db_xref="GeneID:9889998"
FT                   /locus_tag="BATR1942_00155"
FT   CDS_pept        25607..26266
FT                   /locus_tag="BATR1942_00155"
FT                   /gene_family="HOG000273990" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG1802 Transcriptional regulators"
FT                   /db_xref="GI:311066999"
FT                   /db_xref="GeneID:9889998"
FT                   /translation="MKKDIIKPIKRTSFRDEVYLTLKKAIVTLELQPEQRLNDKELAEE
FT                   FGISRTPVREALKRLEDEGLVESIPGSVTRVAPLNLEEAKHAFTVVAALHSLAARLAVP
FT                   LLKEADIQELEFSNKALLLSIEKKDIIKAIEADELFHNVFLDVAGNPEIIRALERSIFK
FT                   IQRLEISQFTSINGLKSVEQHQHIIEACKNKDKETTAHLVEQNWLSLGELLTYETD"
FT                   /protein_id="YP_003971922.1"
FT   gene            26253..27245
FT                   /db_xref="GeneID:9889999"
FT                   /locus_tag="BATR1942_00160"
FT   CDS_pept        26253..27245
FT                   /locus_tag="BATR1942_00160"
FT                   /gene_family="HOG000092544" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="YjlA protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311067000"
FT                   /db_xref="GeneID:9889999"
FT                   /translation="MRQIEVRNLRPIFLGICAAFFFAFTFILNRAMELSGGSWIWSASL
FT                   RFIFMLPFLLLLVMSRKKLKVLLQVMRENLRAWFLWSFVGFGLFYAPLCFAAVHAPGWI
FT                   IAGTWQITIISGSLLAPLFIQTIETPDGILKKRGKIPMKGMGMSLIILLGIFFMQMEQA
FT                   KSLAVKDILLGIIPVIVASFAYPLGNRKMMEVCGNRLDAYQRVLGMTLASLPFWFLLSL
FT                   YGLFTVGVPSKEQTMQSILVAICSGVIATILFFKATDMVKGDMQKLATVEATQSMEVLF
FT                   AVIGELILLHSSFPSILSWCGMFVIMLGMIAHSYVSHKGETAHNPNISA"
FT                   /protein_id="YP_003971923.1"
FT   gene            27522..27650
FT                   /db_xref="GeneID:9890000"
FT                   /locus_tag="BATR1942_00165"
FT   CDS_pept        27522..27650
FT                   /locus_tag="BATR1942_00165"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311067001"
FT                   /db_xref="GeneID:9890000"
FT                   /translation="MALTEVVVREILDRFFDSTAMGNKSFYAEVLLDYQVCVAIRT"
FT                   /protein_id="YP_003971924.1"
FT   gene            28100..28477
FT                   /db_xref="GeneID:9890001"
FT                   /locus_tag="BATR1942_00170"
FT   CDS_pept        28100..28477
FT                   /locus_tag="BATR1942_00170"
FT                   /gene_family="HOG000008759" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative integral inner membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311067002"
FT                   /db_xref="GeneID:9890001"
FT                   /translation="MLKRFSLVLLTLIMSIVVILVAAKYSPGDNVISFDEPRILMISIG
FT                   IIVFLFIPPLAMSFFGNWVVRIISGVYQCFIVLTFMGLIPIGFLIPNGFLTILVSVLGT
FT                   LVSIISVLVTLLIDRNKEVKS"
FT                   /protein_id="YP_003971925.1"
FT   gene            complement(28492..28728)
FT                   /db_xref="GeneID:9890002"
FT                   /locus_tag="BATR1942_00175"
FT   CDS_pept        complement(28492..28728)
FT                   /locus_tag="BATR1942_00175"
FT                   /gene_family="HOG000166452" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative DNA binding protein"
FT                   /transl_table="11"
FT                   /note="COG0462 Phosphoribosylpyrophosphate synthetase"
FT                   /db_xref="GI:311067003"
FT                   /db_xref="GeneID:9890002"
FT                   /translation="MVFEAKSLFSEAENRAKDYTELKNKMIKLRKAIKAFADLYDSKFS
FT                   GKGANNIKAFYHDHVVVTDQWKASFLDSRDQAF"
FT                   /protein_id="YP_003971926.1"
FT   gene            complement(28995..29639)
FT                   /db_xref="GeneID:9890003"
FT                   /locus_tag="BATR1942_00180"
FT   CDS_pept        complement(28995..29639)
FT                   /locus_tag="BATR1942_00180"
FT                   /gene_family="HOG000238705" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="permease"
FT                   /transl_table="11"
FT                   /note="COG2364 Predicted membrane protein"
FT                   /db_xref="GI:311067004"
FT                   /db_xref="GeneID:9890003"
FT                   /translation="MKYTFYVLGILILTLGISFTIQSDLGTSPFDAVVVGLSKNVGLTV
FT                   GSWEIIIAFILICCNSFLKRQRPEILGLLTAFITGIGIDMWLFLLHNLLTPDLWYSKVI
FT                   CFGIGLVVIGLGTATYLHTNFAPIPVDRLTLIIKELTRTNIFFSRTFIYLLFLIAAIIL
FT                   NGPIGVGTLLTVCLGGIILNYFMPFTEKILDRLLTNSSTLPNDGQDKKHSI"
FT                   /protein_id="YP_003971927.1"
FT   gene            29756..30208
FT                   /db_xref="GeneID:9890004"
FT                   /locus_tag="BATR1942_00185"
FT   CDS_pept        29756..30208
FT                   /locus_tag="BATR1942_00185"
FT                   /gene_family="HOG000225730" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MarR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG1846 Transcriptional regulators"
FT                   /db_xref="GI:311067005"
FT                   /db_xref="GeneID:9890004"
FT                   /translation="MKEILREVGMIARALDSISNIEFKEYNLTKGQYLYLVRICENPGI
FT                   IQEKLAEMIKVDRTTAARAIKKLEMNGFIEKVDDEHNKKIKKLFPTEKGKNVFPVIKRE
FT                   NDHSNSVALAGFSEGEAETILHLLQRIRKNIEVDWEYVKKGNKRDY"
FT                   /protein_id="YP_003971928.1"
FT   gene            30227..30751
FT                   /db_xref="GeneID:9890005"
FT                   /locus_tag="BATR1942_00190"
FT   CDS_pept        30227..30751
FT                   /locus_tag="BATR1942_00190"
FT                   /gene_family="HOG000078532" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="polyamine N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="GI:311067006"
FT                   /db_xref="GeneID:9890005"
FT                   /translation="MSISVRLKKCSHEDLKILQEISIETFNDTFKDQNSPENMKAYLES
FT                   AFHSNQLEKELSNISSQFFFVYFNHEVSGYLKVNTNEAQSEKMGDESLEIERIYIKNKF
FT                   QKHGLGKHLFNKAVEVALESNKKKIWLGVWEKNENAIAFYEKMGFVQTGAHSFYMGDEE
FT                   QIDFIMTKTLV"
FT                   /protein_id="YP_003971929.1"
FT   gene            30775..31392
FT                   /db_xref="GeneID:9890006"
FT                   /locus_tag="BATR1942_00195"
FT   CDS_pept        30775..31392
FT                   /locus_tag="BATR1942_00195"
FT                   /gene_family="HOG000218797" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative enzyme"
FT                   /transl_table="11"
FT                   /note="COG2808 Transcriptional regulator"
FT                   /db_xref="GI:311067007"
FT                   /db_xref="GeneID:9890006"
FT                   /translation="MYIPKYYKVTNVDDIWDFVQNNSFGTIVTTAQGKPIATHLPLQLM
FT                   KEGDTYYITGHIAYGNPQWRTFETCEDVLVMFQGPHAYISSSWYEKENVPTWNYQAVHL
FT                   YGTASILNEEELKHDLTMLLQKYEKHRKNPILWDKLSPQLLESQLKGIVGFKIKVGEIQ
FT                   ASYKLSQNRNETDYMNIIDQLRKKGDPNSKQMAELMEKRLKD"
FT                   /protein_id="YP_003971930.1"
FT   gene            complement(31791..31991)
FT                   /db_xref="GeneID:9890007"
FT                   /locus_tag="BATR1942_00200"
FT   CDS_pept        complement(31791..31991)
FT                   /locus_tag="BATR1942_00200"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="GI:311067008"
FT                   /db_xref="GeneID:9890007"
FT                   /translation="MQKLKGQSIAMLSYVDPFVAILISAIILQEQMTIVQMLGGVLLLG
FT                   STFVSENKSITFSKAIKENIS"
FT                   /protein_id="YP_003971931.1"
FT   gene            32122..32241
FT                   /db_xref="GeneID:9890008"
FT                   /locus_tag="BATR1942_00205"
FT   CDS_pept        32122..32241
FT                   /locus_tag="BATR1942_00205"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311067009"
FT                   /db_xref="GeneID:9890008"
FT                   /translation="MGEKIYMYTLLLGDKYKEMSGIQETAKMIVWGYQKNTRL"
FT                   /protein_id="YP_003971932.1"
FT   gene            complement(32394..33776)
FT                   /db_xref="GeneID:9890009"
FT                   /locus_tag="BATR1942_00210"
FT   CDS_pept        complement(32394..33776)
FT                   /locus_tag="BATR1942_00210"
FT                   /gene_family="HOG000261631" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GntR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG1167 Transcriptional regulators containing a
FT                   DNA-binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs"
FT                   /db_xref="GI:311067010"
FT                   /db_xref="GeneID:9890009"
FT                   /translation="MPVNSFEHYPMTWKPDRTQLAPPIYQSIATQLEYDILNGFLAPHT
FT                   KLPPQRELADYLDINLSTVTRAFKLCEVKGLIYGITGSGTYVAPNVSNALFLEDNDNKN
FT                   VIEMGLIEPLDHSNSLVAEVIQNIAGKNYLEKLLDYRNPLGMPYHKMAAKKWMERFNLE
FT                   VPIENIVITSGGQNSLTLILMSLFHAGDKIAVDTYTYPNFIELANMLNIHLVPIDGDSF
FT                   GMMPERLEEACRKNRLNGIYLIPSCNNPTAVTMDMNRRKEIAKIIRKYNLTLLEDDIFS
FT                   FLAPEGFVPISYFVPDQFVYSLSVSKSLSSGMRVGFLAFASQFIDKMTHGIFNINVKTP
FT                   AFNAEVITELINTGCAEKIISQKKNISKERNLLYQKYFQMNNPNENPLTFFRWIPLDKK
FT                   YQMEEFEQDALAQGIRVYHSDRFLAKKDETNQFIRISLTSAKTYEELDKGLRTLKDFLF
FT                   EK"
FT                   /protein_id="YP_003971933.1"
FT   gene            33890..34666
FT                   /db_xref="GeneID:9890010"
FT                   /locus_tag="BATR1942_00215"
FT   CDS_pept        33890..34666
FT                   /locus_tag="BATR1942_00215"
FT                   /gene_family="HOG000251510" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PhzF family phenazine biosynthesis protein"
FT                   /transl_table="11"
FT                   /note="COG0384 Predicted epimerase, PhzC/PhzF homolog"
FT                   /db_xref="GI:311067011"
FT                   /db_xref="GeneID:9890010"
FT                   /translation="MKYYVVDAFAENLFEGNPAGVCIMKEWIPDELMQQIAAENNLSET
FT                   AFAVKEGENYRLRWFTPADEIDLCGHATLATAYVIANFYESNVEEIKFQTISGELVVVK
FT                   KGELYEMDFPSRMPKEISLTEEMVEALGVKPVEVHLGRDLIFVLEKEDDVLNASPDFSK
FT                   LKELPDGLGVLITARSEKCDFVSRAFFPKLNVNEDPVCGSAHCNFIPYWAKNLSKNEMV
FT                   ARQLSKRGGKLYCKFEGDRVKISGSAVLYSIADLQI"
FT                   /protein_id="YP_003971934.1"
FT   gene            complement(35098..36300)
FT                   /db_xref="GeneID:9890011"
FT                   /locus_tag="BATR1942_00220"
FT   CDS_pept        complement(35098..36300)
FT                   /locus_tag="BATR1942_00220"
FT                   /gene_family="HOG000266878" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="efflux transporter"
FT                   /transl_table="11"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="GI:311067012"
FT                   /db_xref="GeneID:9890011"
FT                   /translation="MKKSIKEQKTVLIILLSNIFIVFLGIGLIIPVMPSFMNIMNLSGS
FT                   TMGYLVAVFAVSQLITSPFAGRWVDRFGRKKMIVIGLLVFSISELIFGLGTHVSIFYLS
FT                   RILGGISAAFIMPAVTAYVADITTMQERSKAMGYVSAAISTGFIIGPGAGGFIADYGIR
FT                   MPFFFAAAIACLAAISSVFILKESLPKKEREQLLANTEESNFFKDLKKSIHPVYLIAFI
FT                   IVFVLAFGLSAYETVFSLFSDHKFGFTPKDIAIIITISSIVAVIIQVLLFGKLVNKLGE
FT                   KRVIQLCLIIGAVLAFVSTVMSGFLAVLLVTCFIFLAFDLLRPALTTFLSKVAGNQQGF
FT                   VAGMNSTYTSLGTIFGPALGGILFDLNIHYPFLFAGVVMIIGLSLTMLWKEKSNEVSPL
FT                   N"
FT                   /protein_id="YP_003971935.1"
FT   gene            complement(37736..38599)
FT                   /db_xref="GeneID:9890012"
FT                   /locus_tag="BATR1942_00225"
FT   CDS_pept        complement(37736..38599)
FT                   /locus_tag="BATR1942_00225"
FT                   /gene_family="HOG000216535" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative permease"
FT                   /transl_table="11"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="GI:311067013"
FT                   /db_xref="GeneID:9890012"
FT                   /translation="MNKATSGWMNGFLGVLIFSGSLPATRLAVADFDPLFLTVCRAAIA
FT                   GVLAGALLLTFRQQRPAKSDIIPLLVVAFGVVIGFPLLTALALQYVTSAHAIVFIGLLP
FT                   LATAIFGVLRGGERPRPVFWIFSAAGSLLVAGFALIQGGGSSPLGDAYMLASIVVCGLG
FT                   YAEGARLSRRLGNWQVISWALVLSLPVMLPFSFYFTPDSWSGIGVPALLSLAYVSLFSM
FT                   LIGFVFWYRGLAQGGIAAVGQLQLLQPCFGLLLASVILHEKVGWALVAVNVAVIACVAA
FT                   ARRFAK"
FT                   /protein_id="YP_003971936.1"
FT   gene            38770..40161
FT                   /db_xref="GeneID:9890013"
FT                   /locus_tag="BATR1942_00230"
FT   CDS_pept        38770..40161
FT                   /locus_tag="BATR1942_00230"
FT                   /gene_family="HOG000223052" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative PLP-dependent transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG1167 Transcriptional regulators containing a
FT                   DNA-binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs"
FT                   /db_xref="GI:311067014"
FT                   /db_xref="GeneID:9890013"
FT                   /translation="MDITPFLNRNLNIPLYQQLYQFFKTNMHHGRIQKGMKLPSKRLLA
FT                   SQLSISQTTVERAYEQLAAEGYIVSKPRSGWFADYNGSDFVHSKMPSTSSIKRKAQEDK
FT                   RWIDFHYGNVDSSHFPFSAWRKSMVNSLDQYGYELYRPGNALGELELRKLIAEYLYQSR
FT                   GVNCLPEQVIIGAGNPVLLQILCQVFEPNISIGYEDPGYPRARKIFEANRMNIVPIPVD
FT                   DEGICIQKIQEQQPNLVYVTPSHQFTLGTIMTINRRIQLLKWAAENQSFIIEDDYDGEF
FT                   RYTGQPIPSLQGLDQHNRVIYMGTFSKSLLPSLRISYMILPSPLLKKGHEITSLYKQTV
FT                   SCHSQLTLAEFIKNGEWQKHINRMRKLYRKKRATLLEAGKGELGKYVRIRGENSGLRIL
FT                   LDVYVPYSEKELIEKAKEHGVKIYPVSLSYKNHPPTKTVSLGFAGVSEVNIQEGIKKLK
FT                   AAWKI"
FT                   /protein_id="YP_003971937.1"
FT   gene            40442..41314
FT                   /db_xref="GeneID:9890014"
FT                   /locus_tag="BATR1942_00235"
FT   CDS_pept        40442..41314
FT                   /locus_tag="BATR1942_00235"
FT                   /gene_family="HOG000002780" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="YdeO protein"
FT                   /transl_table="11"
FT                   /note="COG1284 Uncharacterized conserved protein"
FT                   /db_xref="GI:311067015"
FT                   /db_xref="GeneID:9890014"
FT                   /translation="MNTIKKHKKFKAKMILQVIMVMIGGIIAAYGLETVLIPNSVSDGG
FT                   VTGLSIVGSQLFNLPLGILIAVINIPFVWLGYKQIGKSFALLSIIGIASLAAGTSFMHH
FT                   TPAIIEGDTLLITVVGGIILGFGMGLALRNGGALDGIDMLAVLLSRKLPFGTSDLILFL
FT                   NLFVFIFVSTVFGLQGALLSVIAYYIASKVIHVVEEGLSGSKTFQIITTQPELMVETIR
FT                   DQLGRSATYKEAYGGFSYEKFKEITCVINRLEETKLKEIINEIDKSAFVTVYDVAEVKG
FT                   SNFRKLNNH"
FT                   /protein_id="YP_003971938.1"
FT   gene            complement(41570..41812)
FT                   /db_xref="GeneID:9890015"
FT                   /locus_tag="BATR1942_00240"
FT   CDS_pept        complement(41570..41812)
FT                   /locus_tag="BATR1942_00240"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311067016"
FT                   /db_xref="GeneID:9890015"
FT                   /translation="MIDKTLPVAIIGGGQASPQKPTLSKEMNHSFCLNQEKKSEPIFQI
FT                   MVMYGCFHPGNKSIKTIKTELIKSKQHVKLKMKSK"
FT                   /protein_id="YP_003971939.1"
FT   gene            41928..42275
FT                   /db_xref="GeneID:9890016"
FT                   /locus_tag="BATR1942_00245"
FT   CDS_pept        41928..42275
FT                   /locus_tag="BATR1942_00245"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metals sensing ArsR-SmtB repressors family
FT                   transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG0640 Predicted transcriptional regulators"
FT                   /db_xref="GI:311067017"
FT                   /db_xref="GeneID:9890016"
FT                   /translation="MTAQSSLEAVKVVQCLKILSDQTRLIIMKLLQKKEYCVCQFVDMF
FT                   QMSQPAISQHLSKLKKAGLVHETKKGQWRFYSINQSCPEYDLMLSILNKIDCHDKLLQS
FT                   ITQKETQVSCR"
FT                   /protein_id="YP_003971940.1"
FT   gene            42287..43585
FT                   /db_xref="GeneID:9890017"
FT                   /locus_tag="BATR1942_00250"
FT   CDS_pept        42287..43585
FT                   /locus_tag="BATR1942_00250"
FT                   /gene_family="HOG000005271" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative metal-anion antiporter protein"
FT                   /transl_table="11"
FT                   /note="COG1055 Na+/H+ antiporter NhaD and related arsenite
FT                   permeases"
FT                   /db_xref="GI:311067018"
FT                   /db_xref="GeneID:9890017"
FT                   /translation="MLSTILAACIFVLTLVFVIWQPRNLSIGWSACGGAALALIAGVVN
FT                   FQDVIDVTGIVWNATLAFIAIIIISLILDNIGFFEWAALHMAKAAKGNGVLMFVYVTIL
FT                   GAVVAAFFANDGAALILTPIVLAMVRALNLQGKLVFPFIMASGFIADTTSLPLVVSNLV
FT                   NIVSADYFHIGFIEYASRMIVPNLFSLIASIIVLCLFFRKSIPRHYDLSEVKKPVEAIK
FT                   DQKMFRISWYVLGILLVGYLVSELFSIPVSFIAGVIAILFLAMAQKSSAVQTKEVLKGA
FT                   PWAIVFFSIGMYVVVYGLRNAGLTDVLSELIQTASNQGLFAGTIGMGFLAAILSSIMNN
FT                   MPTVMIDALAIAGTDTHGMMREALIYANVIGSDLGPKITPIGSLATLLWLHVLSQKGVK
FT                   ISWGTYFKTGIILTIPTLFITLVGLYVWLLIIH"
FT                   /protein_id="YP_003971941.1"
FT   gene            43610..44029
FT                   /db_xref="GeneID:9890018"
FT                   /locus_tag="BATR1942_00255"
FT   CDS_pept        43610..44029
FT                   /locus_tag="BATR1942_00255"
FT                   /gene_family="HOG000273093" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenate reductase"
FT                   /transl_table="11"
FT                   /note="COG0394 Protein-tyrosine-phosphatase"
FT                   /db_xref="GI:311067019"
FT                   /db_xref="GeneID:9890018"
FT                   /translation="MSKKTIYFLCTGNSCRSQMAEGWAKKHLGDKWNVYSAGIEAHGLN
FT                   PNAVKAMKEVGIDISDQTSDIIDPDILNNADLVVTLCGDAADKCPMTPPHVKREHWGFD
FT                   DPAKAQGTEEEKWAFFQRVRDEIGDRLKQFAETRE"
FT                   /protein_id="YP_003971942.1"
FT   gene            44498..45139
FT                   /db_xref="GeneID:9890019"
FT                   /locus_tag="BATR1942_00260"
FT   CDS_pept        44498..45139
FT                   /locus_tag="BATR1942_00260"
FT                   /gene_family="HOG000140798" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311067020"
FT                   /db_xref="GeneID:9890019"
FT                   /translation="MKNKMKSFCIALIGLFMVGNLIGCTNQQGSQENTTENHKSTHQNT
FT                   SNLKKYSKDPDKNSDDEDFDLIGTLDTETSDQLTLVIDQKKVKVPKSSSFKKEKIGNEN
FT                   VKGKLVKVEIDSKRQEAETLELTPQAKADSNGVYEKDDDGDFKLIGKLIKETDTNVTVQ
FT                   VSKGKKTYKKAADYKKDTEGISGDIQGKIVRLEVKKNNEVESLDIDPEDQ"
FT                   /protein_id="YP_003971943.1"
FT   gene            complement(45589..47067)
FT                   /db_xref="GeneID:9890020"
FT                   /locus_tag="BATR1942_00265"
FT   CDS_pept        complement(45589..47067)
FT                   /locus_tag="BATR1942_00265"
FT                   /gene_family="HOG000262983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sodium/solute symporter family protein"
FT                   /transl_table="11"
FT                   /note="COG0591 Na+/proline symporter"
FT                   /db_xref="GI:311067021"
FT                   /db_xref="GeneID:9890020"
FT                   /translation="MNIALLIILGFLLLAVFLGIRSTKGKKMDLEQWTVGGRGFGAILV
FT                   FLLMAGEIYTTFSFLGGSGWAYGKGAPALYVLMYIALSYVLSYWLLPVIWKYAKENNLL
FT                   SQSDFFVSKYRSPFLGVLVALVGVIGMIPVIVVQLKGMGIIVSQASYGAIPMHTAVWLG
FT                   AISLTVYVMISGVHGSAWIAIIKDIVMVGVIGFLGIYLPIHYYGGFQLMFEAVHTANPE
FT                   FLKFPDQGLSVSWLISTVLLLVLGFYMWPQVFSSTYTAQNEKIFRKNAIISPLYTLMLL
FT                   FVFFVGTAAILKVPGLEGEEVDLSLLRLSIDTFDPWVIGVIGGAGLLTALVPGSLLIMN
FT                   TATLLSKNIYKVFVPSATDQTIGRLAKLLVPVVSLIAVYFTLNGGATLSNIILMGYSLM
FT                   TQLAPSLFFSLMKNNFITKYGAGAGIICGLATVAYITVSHTTIADVFPTFPQSLKDVNT
FT                   GIIALVINCMVMVIVSMVTRKYKHGAAETIKSAK"
FT                   /protein_id="YP_003971944.1"
FT   gene            complement(47064..47282)
FT                   /db_xref="GeneID:9890021"
FT                   /locus_tag="BATR1942_00270"
FT   CDS_pept        complement(47064..47282)
FT                   /locus_tag="BATR1942_00270"
FT                   /gene_family="HOG000262994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311067022"
FT                   /db_xref="GeneID:9890021"
FT                   /translation="MDGDFKMKVVYLLSILPFIGMLCILPFVNRVEPFVFSMPFIMFWV
FT                   AIWTVLTSVILGIMYKLDPRNKEDDKK"
FT                   /protein_id="YP_003971945.1"
FT   gene            47927..48382
FT                   /db_xref="GeneID:9890022"
FT                   /locus_tag="BATR1942_00275"
FT   CDS_pept        47927..48382
FT                   /locus_tag="BATR1942_00275"
FT                   /gene_family="HOG000055310" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative MarR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG1846 Transcriptional regulators"
FT                   /db_xref="GI:311067023"
FT                   /db_xref="GeneID:9890022"
FT                   /translation="MDEKKLCQAIELFAEVLFEGTEFVHREVNQDVFEHISREQADLLM
FT                   ILKIKGPSSPGSLAIIQNVHKSAISNRLKKLLEKGLVEWDDCQIKSDKRSKLIKITEKG
FT                   EKIKEELDSAVFNALEELIDDIDDEHLDSFIEIFTIIKRKFKGELAE"
FT                   /protein_id="YP_003971946.1"
FT   gene            48379..51036
FT                   /db_xref="GeneID:9890023"
FT                   /locus_tag="BATR1942_00280"
FT   CDS_pept        48379..51036
FT                   /locus_tag="BATR1942_00280"
FT                   /gene_family="HOG000292420" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative membrane component"
FT                   /transl_table="11"
FT                   /note="COG2409 Predicted drug exporters of the RND
FT                   superfamily"
FT                   /db_xref="GI:311067024"
FT                   /db_xref="GeneID:9890023"
FT                   /translation="MRFIIKFKWAIAAVILALTVVLSLFSPNLTELANQKGQSQLPADS
FT                   VSEKANAILKQAGENNNSISVVFTLDHALKKDTEDQLRKMIGKIKKINGVEEVMSPLTD
FT                   EKEVKDQLISKDKKTVLIPVTITGSDKKAEKIADDIYKIVPDDLTAYITGASLINQDFG
FT                   HSSEDGLKKTEVITVCLIIGLLLIVFRSIVTPFIPIIIVGFTYLISQSILGILVYNADF
FT                   PISTFTQTFLVAILFGIGTDYCILLLTRFREELANGHDKKEAALIAYRTGGKTIFISGF
FT                   AVLIGFSALGFAKFSIFQSAVGVAVGVGILMIVLFTLLPLFMVTLGGKLFWPSKKVLSH
FT                   SDNKLWAFLGKHSVARPFLFIVITVIITLPFILTYDDQISFDSTAEISSNYKSIKGLQT
FT                   IKDGFGEGKAFPVNVVIKGEKDIATAETIPYLGNISKAIEKVDHVDSVMTITQPTGEKI
FT                   KDLYIDNQLGSVSDGLDKTVKGLGDVQSGLTDVEEGLNQMAGQSGTAANSDSGGSLADT
FT                   ADGLGKINKQLQLVSKQLSQTGNTAQAVPQLTAISGQLRQIQSGLEQADQQLSGQQKQA
FT                   GSLTESLNQLAKGVRSANDGLTKISDGITASSDMLEKMSKSSTIRDTGIFIPDSVMKNK
FT                   DFKTSIDRYSFADGKGVQLSVVLDSNPYSEQAITTVNKIKKAVANEVAGTPLEDTDIVY
FT                   GGVSSTNADLKDLSTTDFSRTMVIMIIGLFLVLTILFRSMVMPIYMIASLLLTYYTSIS
FT                   ITELIFVNFLGNDGVSWAVPFFSFVILIALGIDYSIFLLDRFKEEVHLGIHQGVVRSMS
FT                   KMGSVIITAAIILAGTFAAMMPSGVNTLMQVASVVIIGLLLYGLVILPLLFPAIIVTFG
FT                   EGNWWPFVRKKMKE"
FT                   /protein_id="YP_003971947.1"
FT   gene            51264..53216
FT                   /db_xref="GeneID:9890024"
FT                   /locus_tag="BATR1942_00285"
FT   CDS_pept        51264..53216
FT                   /locus_tag="BATR1942_00285"
FT                   /gene_family="HOG000099531" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ManR protein"
FT                   /transl_table="11"
FT                   /note="COG3711 Transcriptional antiterminator"
FT                   /db_xref="GI:311067025"
FT                   /db_xref="GeneID:9890024"
FT                   /translation="MRYMNTRQKDILYLLLSEPDDYLVVQDFADRVKCSEKTIRNDLKT
FT                   IESYLHEHSPAQLIRKPGLGVYLNIEEHERARLTQQLGTEHFASKQQSDEERILQIAYK
FT                   LLMHPKHVSAKEIAAQLFLNKSSIKRDLHEIEEWLKRFDLKLVSKQRLGLKIEGNERNK
FT                   RKALARISDLIDNPEFTSQFIKSKFLSHEVEFVSNEFKTLQKHHSIYFTDETFENLLLH
FT                   TLLMIRRIKMKQPISISPTEMAAVEKKNEYQWAIACLKRLEAVFAIRFPKEEAVYLTLH
FT                   ILGGKVRFRSREEEKKVLENPLLSMVVRHLIDRVSELKMLDFHSDQDLINGLNIHLNTV
FT                   LNRLNYDLSVSNPMLNDIKKMYPYLFHMIIDVLEDINQTFALSIPEEEAAYLTLHFQAA
FT                   VERLHHSSEKHKKAIILCHMGIGMSQLLRTKIERKFHQIAVKACIAKADLADYTTKHGD
FT                   IDLVISTIALEHVPIPHIVVSPLLEPSDEKKLSAFMDQVEESQRQTQKTFKMLNNTTPF
FT                   LVFLQQESVHRYKLIEQMAMVLYEKGYVEKEYAIHAVMREKMSATNIGAGIAIPHANSK
FT                   FIKQSAIAIATLKEPLDWGAEKVSLVFMLAVKHEDQNITKQLFHELSYLSEQPAFIHKL
FT                   TKETNVMTFLSYLDY"
FT                   /protein_id="YP_003971948.1"
FT   gene            53365..55302
FT                   /db_xref="GeneID:9890025"
FT                   /locus_tag="BATR1942_00290"
FT   CDS_pept        53365..55302
FT                   /locus_tag="BATR1942_00290"
FT                   /gene_family="HOG000227677" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative PTS mannose-specific enzyme IIBCA
FT                   component"
FT                   /transl_table="11"
FT                   /note="COG1445 Phosphotransferase system fructose-specific
FT                   component IIB"
FT                   /db_xref="GI:311067026"
FT                   /db_xref="GeneID:9890025"
FT                   /translation="MKLLAITSCPNGIAHTYMAAENLQKAADRLGVQMKVETQGGIGVE
FT                   NELTGEEIREADAIIIAADRSVNKDRFIGKKLLSVGVQDGIRKPEELIQKALSGDVPVY
FT                   RSASKSEVGNQQEKKQNPIYRHLMNGVSFMVPFIVVGGLLIAVALTLGGEKTPKGLVIP
FT                   DDSFWKTIEQIGSASFSFMIPILAGYIAYSIADKPGLVPGMIGGYIAATGSFYGSASGA
FT                   GFLGGIIGGFLAGYAALWIKKLKVPKAIQPIMPIIIIPVFASLIVGLAFVFLIGAPVAQ
FT                   IFESLTVWLAGMKGSSSILLALILGAMISFDMGGPVNKVAFLFGSAMIGEGNYEIMGPI
FT                   AVAICIPPIGLGIATFFGKRKFQESEREMGKASFTMGLFGITEGAIPFAAQDPLRVIPG
FT                   IMAGSMTGSVIAMIGNVGDRVAHGGPIVAILGAVDHVLMFFIAVIAGSLTTALLVNVLK
FT                   KDITVSPAGLSEAAASNDFPQQHNEAESRQMEKTDINKLTDIMSIDLIEPTLSGETRDD
FT                   IIDEMIQKLSRTGMLHSESGFKQAIMNREQEGTTAIGMNIAIPHGKSDAVKKPSVAFGI
FT                   KRSGIDWNSLDGSEAKLIFMIAVPKDSGGNQHLKLLQMLSRKLMDDSYRERLLSVQTKE
FT                   EAYQLLDEII"
FT                   /protein_id="YP_003971949.1"
FT   gene            55320..56264
FT                   /db_xref="GeneID:9890026"
FT                   /locus_tag="BATR1942_00295"
FT   CDS_pept        55320..56264
FT                   /locus_tag="BATR1942_00295"
FT                   /gene_family="HOG000054245" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mannose-6-phosphate isomerase manA"
FT                   /transl_table="11"
FT                   /note="COG1482 Phosphomannose isomerase"
FT                   /db_xref="GI:311067027"
FT                   /db_xref="GeneID:9890026"
FT                   /translation="MTEPLFFKPVFKEKIWGGTALAAFGYDIPSERTAECWAFAAHQNG
FT                   QSIVQNGIYKGLTLSELWEHHRHLFGHLKGDRFPLLTKILDANQDLSVQVHPKDEYAKT
FT                   REKGELGKTECWYIIDCQEDAEIIYGHNAKTKEELISMIEVGKWDELLRRVKVKPGDFF
FT                   YVPSGTVHAIGKGILILETQQNSDTTYRLYDYGRKDTEGNLRELHLEKSIEVIDVPFAP
FT                   DQQTVQYEQIDDLRIAVLIECPYFSVEKWDLKGSASLKQQKSFLLVSVLEGEGRMISGE
FT                   RTYDFKKGDHMLLPYGFGEFKLAGDAECIVSNL"
FT                   /protein_id="YP_003971950.1"
FT   gene            complement(56751..57650)
FT                   /db_xref="GeneID:9890027"
FT                   /locus_tag="BATR1942_00300"
FT   CDS_pept        complement(56751..57650)
FT                   /locus_tag="BATR1942_00300"
FT                   /gene_family="HOG000184105" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative permease"
FT                   /transl_table="11"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="GI:311067028"
FT                   /db_xref="GeneID:9890027"
FT                   /translation="MKKKTVQLIISYSLMIGLWASAFPGIRVGLEYYTPEHLALFRLLI
FT                   GSMALLLFAVLTKMRLPDMKDIPVILLLGFLGFALYHILLNIGEKTVSAGIASLLVTTA
FT                   PIFSAVLSRLFFGEHFGFSKWIGSIISLLGVSFISFGTGDHTHSMKGILFILLAAFSES
FT                   IYFVFQARYIKKYGFIPFVTFTIWGATIPMLVFLPGLWGEFVNASMNSTLSIVYLGLFP
FT                   TVIPYFALAYVTSMVGASEATISLYVTPALTLVISWVWIGEMPAFISLLGGMVTVSGVC
FT                   FTYIKGSKMKMLKEIRKF"
FT                   /protein_id="YP_003971951.1"
FT   gene            57783..59231
FT                   /db_xref="GeneID:9890028"
FT                   /locus_tag="BATR1942_00305"
FT   CDS_pept        57783..59231
FT                   /locus_tag="BATR1942_00305"
FT                   /gene_family="HOG000223054" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative PLP-dependent transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG1167 Transcriptional regulators containing a
FT                   DNA-binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs"
FT                   /db_xref="GI:311067029"
FT                   /db_xref="GeneID:9890028"
FT                   /translation="MSFTEEKTVRKLPKYIQIIDYIKEKIGNGEWPIGSKIPSQRTLAK
FT                   DFHVNRSTVITALEELMADGLIEGRMGKGTVVINNTWTLLAKNSAPNWEKYVTSGIQQP
FT                   SRRIVQEINKSESNSDLIQLSKGELSNEIFPLSAMKEIMGKVSQNIEAFGYEEPKGYLP
FT                   LREALSDYLKTIGIHASPSSILIVSGALQALQLISMGLLQRGSTVFLDQPSYLYSLHVF
FT                   QSAGMNLTGLPMDKEGLLPNHIHMTKGERGRAILYTNPCFHNPTGILMSEERRKEILAA
FT                   SEKTQLPIIEDDIYRELWIDEIPPYPIKTIDKNGHVLYVGSLSKTLSPGLRIGWIVGPE
FT                   PVIERLSDIKMQTDYGSSSLSQRVAAEWFTSGQYQKHLEQVRHQLKIRRQFVTSALETN
FT                   MKNAAVWTIPKGGFFIWLKILPSISMKLLYKKALTKGVLLNLGSIYAQEKGNYIRLSYA
FT                   YASLEDLQKGIYQLSLIIKKLASK"
FT                   /protein_id="YP_003971952.1"
FT   gene            59450..60223
FT                   /db_xref="GeneID:9890029"
FT                   /locus_tag="BATR1942_00310"
FT   CDS_pept        59450..60223
FT                   /locus_tag="BATR1942_00310"
FT                   /gene_family="HOG000097754" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative acetyltransferase"
FT                   /transl_table="11"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="GI:311067030"
FT                   /db_xref="GeneID:9890029"
FT                   /translation="MQEVKKEQYSDVKTLLHNKETCCPTFVYSILEQTISGVVYADDQS
FT                   FLIGTSSGIYYVAGDERNQNCNEFIVDLYKRKTESKKRFTLFSSNRSWDSVIRTVLHDE
FT                   LSQMMRYAFSQQISAKKAFQLPKGFTLKRINEDIISSSTEFQKAYYEEYWGSVSNFLKN
FT                   GFGFAVLYDNHVVSECTSIFLGGNRAEMDIYTREEYRGMGFAYIAGSKFINDCLENGVS
FT                   PSWDCDVSNKSSIHSAKKLGFEISTKYSIFFKKSG"
FT                   /protein_id="YP_003971953.1"
FT   gene            complement(60310..61071)
FT                   /db_xref="GeneID:9890030"
FT                   /locus_tag="BATR1942_00315"
FT   CDS_pept        complement(60310..61071)
FT                   /locus_tag="BATR1942_00315"
FT                   /gene_family="HOG000292832" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative beta-lactamase"
FT                   /transl_table="11"
FT                   /note="COG2220 Predicted Zn-dependent hydrolases of the
FT                   beta-lactamase fold"
FT                   /db_xref="GI:311067031"
FT                   /db_xref="GeneID:9890030"
FT                   /translation="MNIQQIRNATLVVEYAGKTFLIDPMLAEKGTYPPFPNSPRQDQKN
FT                   PLVSLPTSVDHMINNLDAVIVTHLHLDHFDDAAKDMLPKDMKMFVQNEEDAKEVRNAGF
FT                   QNVEILTTDTVFEGIQLIKTKGEHGRGDILKLAGLVCGVVFKHQSEKTLYVAGDTVWYD
FT                   AIQEEIDTHQPEIIVVNGGNNQFFEGGSLVMGKEDIYETHKAAPHAKIIVSHMEAVNHW
FT                   TLSREELKSFIHEKGMLSHVLVPDDGESYSF"
FT                   /protein_id="YP_003971954.1"
FT   gene            61367..61786
FT                   /db_xref="GeneID:9890031"
FT                   /locus_tag="BATR1942_00320"
FT   CDS_pept        61367..61786
FT                   /locus_tag="BATR1942_00320"
FT                   /gene_family="HOG000115327" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LrpA protein"
FT                   /transl_table="11"
FT                   /note="COG1522 Transcriptional regulators"
FT                   /db_xref="GI:311067032"
FT                   /db_xref="GeneID:9890031"
FT                   /translation="MLDHTDMRIIEELSKTSRITMKELGEKVHLTGQAAASRVAKLEDN
FT                   GVIDRYTIKVNQDKLGYSIHALINIYTKSTHHQPYLSFIKTQETYVINNYKISGDGCYL
FT                   LECRFPSNELLDEFLVGLNKHVNYKLSIIINNMQQ"
FT                   /protein_id="YP_003971955.1"
FT   gene            61840..62073
FT                   /db_xref="GeneID:9890032"
FT                   /locus_tag="BATR1942_00325"
FT   CDS_pept        61840..62073
FT                   /locus_tag="BATR1942_00325"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="O-methyltransferase"
FT                   /transl_table="11"
FT                   /note="COG4122 Predicted O-methyltransferase"
FT                   /db_xref="GI:311067033"
FT                   /db_xref="GeneID:9890032"
FT                   /translation="MVFVIRRKDTEVMKTFNQTVANHPQLESILIPISDGVTVAKVKSG
FT                   DKQIVNIIWICGVLWKQGAAAPAVELNGQQLI"
FT                   /protein_id="YP_003971956.1"
FT   gene            complement(62327..63961)
FT                   /db_xref="GeneID:9890033"
FT                   /locus_tag="BATR1942_00330"
FT   CDS_pept        complement(62327..63961)
FT                   /locus_tag="BATR1942_00330"
FT                   /gene_family="HOG000271631" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP-binding cassette efflux transporter"
FT                   /transl_table="11"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="GI:311067034"
FT                   /db_xref="GeneID:9890033"
FT                   /translation="MKERLKLTNVSYEVKDLTVFKNINASVQQGDIIGIIGKNGAGKST
FT                   LLHLINKDLTPSQGQIQWMQHGLKTVLVEQETESYSFENQTPAEVKLLEKWNVPARDFR
FT                   QLSGGEKLKARLAKGLSEDADLFLLDEPTNHLDDISLQFLIQQLKNVTGTVILVSHDRY
FT                   FLDEAATKIWSIEGHTLTEYKGNYSGYMKFRKEKRLTQQREYEKQQKMIERIESQMTEL
FT                   TSWSKKAHAQSTKKEGFKEYHRVKAKRTDAQIKSKQKRLEKELEKTKAEPVDPEYTVRF
FT                   SIDTTHKTGKRFWEVQNLTKSFGEKTLFQNARFTIQHGEKVAITGPNGSGKTTLLKVIL
FT                   GQETAEGKVWISPSAKIGYLTQEVFDLPLEQAPEELFYQDTFEARGNVQNIMKRLGFTA
FT                   SQWTEPIQHMSMGERVKCKLMVYILEEKDVLILDEPTNHLDLPSREQLEETLSQYSGTL
FT                   IVVSHDRYFLEKTTDSKLVISNNHIQKQLNKAPAKRNDQEELRLQLETERQEVLGKLSF
FT                   MTPNDKAYKELDQAFNELTKRINELDQ"
FT                   /protein_id="YP_003971957.1"
FT   gene            64573..65007
FT                   /db_xref="GeneID:9890034"
FT                   /locus_tag="BATR1942_00335"
FT   CDS_pept        64573..65007
FT                   /locus_tag="BATR1942_00335"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative hydrolase"
FT                   /transl_table="11"
FT                   /note="COG0596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="GI:311067035"
FT                   /db_xref="GeneID:9890034"
FT                   /translation="MTFEEVYNKWFQQCPQLFMENLKKDLRLEIIKLSSSLGRDSDDQS
FT                   HPINDEHTKRMIGNLKYFITYEIPGICSRTFDLDVLKSSSVQVLPAGGSTSQDFFPYHC
FT                   ARALGEQLETEIVKFPGHHNGYRIHPKEFADRLHDVLVNY"
FT                   /protein_id="YP_003971958.1"
FT   gene            complement(65074..65490)
FT                   /db_xref="GeneID:9890035"
FT                   /locus_tag="BATR1942_00340"
FT   CDS_pept        complement(65074..65490)
FT                   /locus_tag="BATR1942_00340"
FT                   /gene_family="HOG000166453" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311067036"
FT                   /db_xref="GeneID:9890035"
FT                   /translation="MRKLVFGAFFLIILVSILVSFSLYNGKHNKELEESINSAFKENSV
FT                   EKIDLNSLTDFDWDKAYIFPPYTPQESINEQIGINFKDPSSIDYRDDIYLIVFVNHDKV
FT                   VQYAEISRENGDVSTPDDALTPSNATLKINRDVF"
FT                   /protein_id="YP_003971959.1"
FT   gene            complement(65757..66365)
FT                   /db_xref="GeneID:9890036"
FT                   /locus_tag="BATR1942_00345"
FT   CDS_pept        complement(65757..66365)
FT                   /locus_tag="BATR1942_00345"
FT                   /gene_family="HOG000049472" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311067037"
FT                   /db_xref="GeneID:9890036"
FT                   /translation="MLIFIVIYISYTLLENLVTDSQSADFLSHKTVPRDSFNLPFWLNV
FT                   MYVHVIFACFAMLTGAINFSGKIVTRNRKFHRLNGYFYFISVLIVTLSSGYMAPHSTGG
FT                   RIVSIAFNMVNIIWPSMTIIAIYQVRRKQFNKHRKWMIRSYLFCFTNLFIHMITFMCTN
FT                   GLGFIYEISYTIGVYGAITLNVVIAECIIRIFKKRLNTL"
FT                   /protein_id="YP_003971960.1"
FT   gene            complement(66418..66552)
FT                   /db_xref="GeneID:9890037"
FT                   /locus_tag="BATR1942_00350"
FT   CDS_pept        complement(66418..66552)
FT                   /locus_tag="BATR1942_00350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311067038"
FT                   /db_xref="GeneID:9890037"
FT                   /translation="MRTYSINKICSGTSIPLRFAIEGPFFYDKKSKATHLTASIEGGT"
FT                   /protein_id="YP_003971961.1"
FT   gene            67027..67833
FT                   /db_xref="GeneID:9890038"
FT                   /locus_tag="BATR1942_00355"
FT   CDS_pept        67027..67833
FT                   /locus_tag="BATR1942_00355"
FT                   /gene_family="HOG000296772" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="beta-lactamase"
FT                   /transl_table="11"
FT                   /note="COG2602 Beta-lactamase class D"
FT                   /db_xref="GI:311067039"
FT                   /db_xref="GeneID:9890038"
FT                   /translation="MKKRKMPAVFLALIGAAGLLFTTSVQPISEASAAEKNLNIKKLDV
FT                   DEFFADHNGTFILRDMNKGKTFIYNHERANQRFAPQSTFKVPNALIGLQVGAVEDEYSI
FT                   KYWDGVKREIDIWNQDHTLGSGMRHSVVWYYQAMARDIGESRMKEWIEKISYGNQDISG
FT                   GIDQFWLSSTLKISPIEQADFMERLYKENLPFDKDVMKTVKRMMIQEEEDHSTLYGKTG
FT                   SGTGIGWFFGFVKIDNRAYSFVTNIDGTGAEAKNITMDILKKYKLY"
FT                   /protein_id="YP_003971962.1"
FT   gene            complement(67945..68415)
FT                   /db_xref="GeneID:9890039"
FT                   /locus_tag="BATR1942_00360"
FT   CDS_pept        complement(67945..68415)
FT                   /locus_tag="BATR1942_00360"
FT                   /gene_family="HOG000093102" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:311067040"
FT                   /db_xref="GeneID:9890039"
FT                   /translation="MNSIDVIILNFHEVRRRSIKVWTSIPEEKLHWKPDHEAMSCLEMI
FT                   RHVLESEHYYHLAIKNRGSLSVFNSPFEHRPFTTVTDELAFAEPYRNQFIDTIKTFSEE
FT                   DLEDIKIDRTDAGYIRDLGDMLLRVAYHESVHAGQLLDYLRSADVPRVRVWD"
FT                   /protein_id="YP_003971963.1"
FT   gene            68587..69804
FT                   /db_xref="GeneID:9890040"
FT                   /locus_tag="BATR1942_00365"
FT   CDS_pept        68587..69804
FT                   /locus_tag="BATR1942_00365"
FT                   /gene_family="HOG000143170" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative efflux transporter"
FT                   /transl_table="11"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="GI:311067041"
FT                   /db_xref="GeneID:9890040"
FT                   /translation="MLHNPTGKERLALAFLLGMLAILGPLNIDMYLPSFPEIADDLSAR
FT                   ASLVQLSLTACLIGLTIGQIIVGPVSDAKGRRKPLLICIFLFALSSLFCALSPNITTLV
FT                   IARFLQGFTASAGLVLSRAIVRDVFTGRELSKFFSLLMVITAVAPMVAPMTGGAILLLP
FT                   FATWHTIFHFLTLIGFILVLIIALRLKETLPPEKRIPSSIGTSVRTMGSLMKDRSFIGY
FT                   ALTVGFIHGGSFAYVSGTPFVYQDIYGVSPQVFSILFGINGLAIITGSFIIGRFGGIIH
FT                   EKSLLRIAVITAFIATAVLLTMTIVHGPLITLVISIFIYMITIGMVLTSTFTLAMENQG
FT                   RRAGSASAMLGMLPLLLGSIVSPLVGINETTAIPMGAIMFITSVIGSLAFFKLTKQKAE
FT                   QQKGKI"
FT                   /protein_id="YP_003971964.1"
FT   gene            70328..71539
FT                   /db_xref="GeneID:9890041"
FT                   /locus_tag="BATR1942_00370"