(data stored in SCRATCH zone)

HOGENOMDNA: BATHU1_2

ID   BATHU1_2; SV 1; empty ; DNA; empty ; PRO; 77112 BP.
XX
AC   NC_006578;
XX
PR   Project: 58089;
XX
DE   Bacillus thuringiensis serovar konkukian str. 97-27 plasmid pBT9727,
DE   complete sequence.
XX
OS   Bacillus thuringiensis serovar konkukian str. 97-27
OC   Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus; Bacillus cereus
OC   group.
XX
RN   [1]
RP   1-77112
RX   PUBMED; 16621833.
RA   Han,C.S., Xie,G., Challacombe,J.F., Altherr,M.R., Bhotika,S.S., Brown,N.,
RA   Bruce,D., Campbell,C.S., Campbell,M.L., Chen,J., Chertkov,O., Cleland,C.,
RA   Dimitrijevic,M., Doggett,N.A., Fawcett,J.J., Glavina,T., Goodwin,L.A.,
RA   Green,L.D., Hill,K.K., Hitchcock,P., Jackson,P.J., Keim,P.,
RA   Kewalramani,A.R., Longmire,J., Lucas,S., Malfatti,S., McMurry,K.,
RA   Meincke,L.J., Misra,M., Moseman,B.L., Mundt,M., Munk,A.C., Okinaka,R.T.,
RA   Parson-Quintana,B., Reilly,L.P., Richardson,P., Robinson,D.L., Rubin,E.,
RA   Saunders,E., Tapia,R., Tesmer,J.G., Thayer,N., Thompson,L.S., Tice,H.,
RA   Ticknor,L.O., Wills,P.L., Brettin,T.S. and Gilna,P.;
RT   "Pathogenomic sequence analysis of Bacillus cereus and Bacillus
RT   thuringiensis isolates closely related to Bacillus anthracis";
RL   J. Bacteriol. 188 (9), 3382-3390 (2006)
XX
RN   [2]
RP   1-77112
RG   Joint Genome Institute Microbial Sequencing, Finishing and
RT   "A 77 kb plasmid sequence of Bacillus thuringiensis 97-27";
RL   Unpublished
XX
RN   [3]
RP   1-77112
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (30-DEC-2004) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [4]
RP   1-77112
RG   Joint Genome Institute Microbial Sequencing, Finishing and
RT   "Direct Submission";
RL   Submitted (15-DEC-2004) Joint Genome Institute, Department of Energy, 2800
RL   Mitchell Drive, Walnut Creek, CA 94598, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000047.
CC   Bacillus thuringiensis 97-27 (subsp. konkukian (serotype H34)) was
CC   originally isolated from a case of severe human tissue necrosis
CC   (Bacillus thuringiensis subsp. konkukian (serotype H34)
CC   superinfection: Case report and experimental evidence of
CC   pathogenicity in immunosupporessed mice. Hernandez, E, Ramisse, F,
CC   Ducoureau, J-P, Cruel, T, and Cavallo, J-D. J Clin Microbiol 1998
CC   36(7):2138-2139). B. thuringiensis is indigenous to many habitats
CC   worldwide; these include soil, insects, deciduous and coniferous
CC   leaves (Prediction of insecticidal activity of Bacillus
CC   thuringiensis strains by polymerase chain reaction product
CC   profiles. Carozzi, NB, Kramer, VC, Warren, GW, Evola, S, and
CC   Koziel, MG. Appl Environ Microbiol. 1991 57(11):3057-61). B.
CC   thuringiensis is an insect pathogen that is widely used as a
CC   biopesticide in commercial agriculture. Infection of humans is
CC   unusual. The apparent pathogenic properties of B. thuringiensis
CC   97-27 are very unusual for B. thuringiensis; unlike most B.
CC   thuringiensis isolates, this isolate is very closely related to B.
CC   anthracis based on phylogenetic analysis (Fluorescent amplified
CC   fragment length polymorphism analysis of Bacillus anthracis,
CC   Bacillus cereus, and Bacillus thuringiensis isolates. Hill, KK,
CC   Ticknor, LO, Okinaka, RT, Asay, M, Blair, H, Bliss, KA, Laker, M,
CC   Pardington, PE, Richardson, AP, Tonks, M, Beecher, DJ, Kemp, JD,
CC   Kolsto, A-B, Wong, ACL, Keim, P, and Jackson, PJ. Appl Environ
CC   Microbiol 70(2):1068-1080. Plasmid and fosmid libraries were
CC   prepared at the Joint Genome Institute in Los Alamos (JGI-LANL),
CC   NM. Shotgun sequencing was performed at the JGI Production Genomics
CC   Facility (JGI-PGF) in Walnut Creek, CA to a coverage of 15x. Gene
CC   predictions were obtained using Glimmer. Basic analysis of the gene
CC   predictions was performed by comparing coding sequences against the
CC   PFam, COGS, BLOCKS and Prodom databases. Gene definitions and
CC   functional classes were added manually by a team of annotators at
CC   JGI-LANL, using BLAST results in addition to information from the
CC   basic analysis. A total of 80 genes have been annotated on the
CC   sequence record.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..77112
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:281309"
FT                   /strain="97-27"
FT                   /serovar="konkukian"
FT                   /plasmid="pBT9727"
FT                   /organism="Bacillus thuringiensis serovar konkukian str.
FT                   97-27"
FT   gene            complement(join(77090..77112,1..586))
FT                   /db_xref="GeneID:3200518"
FT                   /locus_tag="pBT9727_0001"
FT   CDS_pept        complement(join(77090..77112,1..586))
FT                   /locus_tag="pBT9727_0001"
FT                   /gene_family="HOG000034613" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899950"
FT                   /db_xref="GeneID:3200518"
FT                   /translation="MAYEKLFQFRGNKIHVDIVQDFQKQYPEYSREADVLRHAVVLLDE
FT                   EMREKKGEDDLSLLKKEVKNLTQSVNAMKQQMDVLIKLNMELISRSGSDFSIEEMQQEV
FT                   KKKIGAAVTKKSEGKFSRTSKRVPMEVEKEETVQQQMEVQNEIKSSYKTVRNLPMIKDD
FT                   EEILMINDKPHKKIWKFGSQLNEEIKWEQIPEHRLDELK"
FT                   /protein_id="YP_173244.1"
FT   gene            complement(604..891)
FT                   /db_xref="GeneID:3200493"
FT                   /locus_tag="pBT9727_0002"
FT   CDS_pept        complement(604..891)
FT                   /locus_tag="pBT9727_0002"
FT                   /gene_family="HOG000034614" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899873"
FT                   /db_xref="GeneID:3200493"
FT                   /translation="MDIHVRNINPNHIAEIDKRCKEIGKKLGRRYYRWEYINMMFEEHF
FT                   DREYKRKKEDKFDEAVTNVSVTLDRQSDKLQEYIDATNELVASMMKLHEG"
FT                   /protein_id="YP_173245.1"
FT   gene            complement(1255..2112)
FT                   /db_xref="GeneID:3200468"
FT                   /locus_tag="pBT9727_0003"
FT   CDS_pept        complement(1255..2112)
FT                   /locus_tag="pBT9727_0003"
FT                   /gene_family="HOG000034616" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899874"
FT                   /db_xref="GeneID:3200468"
FT                   /translation="MRLKFWENKDVRKPANAKRKAYLLTLGSFVTMFFVLCISPVFSGA
FT                   TYKFEEMKPGEYKSITTLVKISVARKEYNPANKTLRIDYELRSDNDPQLLSNMKYKVET
FT                   KYINQKDNNVKTKVYRASDNYIVVISENVPEGFGALSSIVKPEYIHPELQTDPNDLKDR
FT                   SIKTYVLEGNKIINKDLKVESKDFYEKDYLTFSQKGLNKEIKDMKQKIENKNFAIEQLK
FT                   IKNDKLTKEMNFQTEAEKTKTKNIINSNISTINRNEKEINELKEEIKMKEKKIQLLNEK
FT                   KKTV"
FT                   /protein_id="YP_173246.1"
FT   gene            complement(2103..2381)
FT                   /db_xref="GeneID:3200458"
FT                   /locus_tag="pBT9727_0004"
FT   CDS_pept        complement(2103..2381)
FT                   /locus_tag="pBT9727_0004"
FT                   /gene_family="HOG000034617" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899875"
FT                   /db_xref="GeneID:3200458"
FT                   /translation="MLLSELKPSHDYSKEGKYIVIKLWKRKNDYQEIIIDWFDYNPGNK
FT                   FEWLIVRECQLNHGGKKKYTNYKLKNIHPIVKVQVQVFRKGGKEICV"
FT                   /protein_id="YP_173247.1"
FT   gene            complement(2438..2680)
FT                   /db_xref="GeneID:3200503"
FT                   /locus_tag="pBT9727_0005"
FT   CDS_pept        complement(2438..2680)
FT                   /locus_tag="pBT9727_0005"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899876"
FT                   /db_xref="GeneID:3200503"
FT                   /translation="MKERVLEMQPLRENFKLIGKEKDYIFQALTYMGEASAQISWANTV
FT                   LEDVDKVPRELKDAMIQVNQVIHDLQEKLRKINAG"
FT                   /protein_id="YP_173248.1"
FT   gene            complement(2756..3364)
FT                   /db_xref="GeneID:3200456"
FT                   /locus_tag="pBT9727_0006"
FT   CDS_pept        complement(2756..3364)
FT                   /locus_tag="pBT9727_0006"
FT                   /gene_family="HOG000034618" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899877"
FT                   /db_xref="GeneID:3200456"
FT                   /translation="MNMPTKILTGLLSISLVFNGIVIYSTIKEFDKKDKKHQVDIAKKD
FT                   KAIGELKAKIDHLNLKAMTNDADSNKENTNPVVDLQKQYKEVSNQFIQAYLNYSVKNKG
FT                   ERRNNLLKMTDKKVVDMVAPETEDIGDPNFKSTVNQMAMFVDSADDISNKCNVLIDVDY
FT                   TIEGLENKHTKIKSLLRVTLEKKGNEIKVVDYSPYRLSR"
FT                   /protein_id="YP_173249.1"
FT   gene            complement(3389..4531)
FT                   /db_xref="GeneID:3200461"
FT                   /locus_tag="pBT9727_0007"
FT   CDS_pept        complement(3389..4531)
FT                   /locus_tag="pBT9727_0007"
FT                   /gene_family="HOG000267549" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="NLP/P60 family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899878"
FT                   /db_xref="GeneID:3200461"
FT                   /translation="MQTTQNTQGTVVDKYKRIKRLKKLYSLLGSSGILVIGACILSLVV
FT                   LIAVLGGGDSKSKSGSGSLISGTASVNNLPPEVMRWKDMVEKECAAQGVPELVPYVLAI
FT                   IMVESNGISEKLPDIMQSSESQGWKMNTISNPKDSIYYGVMHLKGAFDDAKMLGINDLL
FT                   AIVQTYNFGRNYVHWLAANNKTHSLETADNYSLTVVAPAGGNKNGTRIGYSQAVAVAYN
FT                   GGYRYINGGNFFYAEMVKQYLSFDNGTAPVNGSETFKAIMNEALKYNGNPYVWGGKTPA
FT                   QGFDCSGLTSWAFRAAGVNLNGSAAEQYAATVPVDPKDAQPGDLVFFKGTYGGPDHVSH
FT                   VGIYVDANTMYDSENAGIGYHQFTSPGWQKYYAGIRRVAR"
FT                   /protein_id="YP_173250.1"
FT   misc_feature    complement(3401..3724)
FT                   /note="NlpC/P60 family; Region: NLPC_P60; cl11438"
FT                   /db_xref="CDD:164223"
FT                   /locus_tag="pBT9727_0007"
FT   gene            complement(4533..6470)
FT                   /db_xref="GeneID:3200464"
FT                   /locus_tag="pBT9727_0008"
FT   CDS_pept        complement(4533..6470)
FT                   /locus_tag="pBT9727_0008"
FT                   /gene_family="HOG000034619" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="ATPase"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899879"
FT                   /db_xref="GeneID:3200464"
FT                   /translation="MVKLGRKEQQKYQKKGYDLEFIQRVQPQGGIKFNEKYIAQGDCYV
FT                   ACLHVYSLAEDIPPLWLTSLMNNKDTLSSFDIATANKEEVIKDINRSISELRDRSETER
FT                   RATDRDDANWELQNLKLFANAITQQGEIVKLVALRIFIYDPVLEQLEKRIGDLKKEIAG
FT                   QNYKAQVYVFKQKEEWQSLFASYDQQIEYLGTKAGIPLPSTNIGHGLPFHHQDLKDPRG
FT                   IYLGQTSTGGAFILDPFYSTSTRTSFSGFVFGKMGAGKSTFLKQLLEGLLAKDCFIRGF
FT                   DKAKDYYTIVQQQGGKIIDLSGAKSNGIVETGMINPLEVFATIINETSGEVDEKGSFLQ
FT                   HLSKLTNMLRFLSVDISETVVKEFRNYLLEFYIQYGLIPKRGENKPFKITGLPPKEYPI
FT                   MEEFLKYLNEVELEKGSTAQRLRDLETLRVQVRDMVIVYGDIFNGHTTLRNFEDEKIVF
FT                   FDIDGISKIDKPIFNCQLFTALTLIWSHALKNGRRMKYLREEKKYPFEDLTYFMVLLDE
FT                   CHNVINSENKFANRYILEFEREMRKFFAGIFFATQSPQEMLPPPGSNVDVSDMKAIFEL
FT                   TQYKMFLNMDNSVLETLKSVLGESLTESEFRILPELKRGEAIVQVSSTETYNVMFDPDE
FT                   KQLERFKGGQ"
FT                   /protein_id="YP_173251.1"
FT   misc_feature    complement(<5514..>6164)
FT                   /note="Type IV secretory pathway, VirB4 components
FT                   [Intracellular trafficking and secretion]; Region: VirB4;
FT                   COG3451"
FT                   /db_xref="CDD:33254"
FT                   /locus_tag="pBT9727_0008"
FT   misc_feature    complement(4614..>5816)
FT                   /note="HerA helicase [Replication, recombination, and
FT                   repair]; Region: COG0433"
FT                   /db_xref="CDD:30782"
FT                   /locus_tag="pBT9727_0008"
FT   gene            complement(6485..7159)
FT                   /db_xref="GeneID:3200525"
FT                   /locus_tag="pBT9727_0009"
FT   CDS_pept        complement(6485..7159)
FT                   /locus_tag="pBT9727_0009"
FT                   /gene_family="HOG000034620" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899880"
FT                   /db_xref="GeneID:3200525"
FT                   /translation="MNMKVATVEPKKMKQKKQVDPADHNEKQGFISTIFASFKNADVPI
FT                   LDVSPYKRIDKDSGILIDCRDNLQVYLKVRTTDLYSMNDDDLRRFMNQLTNLCKVYHEP
FT                   FKVLSLTYSTETTEQQVYWKRMALRFQTKMNREEVTNEEARVCYQRYSLAVENLNRALW
FT                   VEKNLKELAFFIVVYGANEKELVKNVKDMKRYGGRQFDLQNMKAKEVEKLIFKMQNMNS
FT                   EM"
FT                   /protein_id="YP_173252.1"
FT   gene            complement(7216..7530)
FT                   /db_xref="GeneID:3200524"
FT                   /locus_tag="pBT9727_0010"
FT   CDS_pept        complement(7216..7530)
FT                   /locus_tag="pBT9727_0010"
FT                   /gene_family="HOG000034621" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899881"
FT                   /db_xref="GeneID:3200524"
FT                   /translation="MEMLRNPKNTKQEIKIAFFYLIDAGIVGLMLLLASYMPKFIPVGG
FT                   FARIMFYVLFGAFGLFLCIKPANSPTNRNMMVIIDMLKQDNKNYHPIEVKRISSETENK
FT                   "
FT                   /protein_id="YP_173253.1"
FT   gene            complement(7601..7798)
FT                   /db_xref="GeneID:3200492"
FT                   /locus_tag="pBT9727_0011"
FT   CDS_pept        complement(7601..7798)
FT                   /locus_tag="pBT9727_0011"
FT                   /gene_family="HOG000034623" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899882"
FT                   /db_xref="GeneID:3200492"
FT                   /translation="MSNWLFAICMLGVAIVISMIATFFKQIFRLLKRKKKKEPELVTVM
FT                   SAEYIDKDFLGRTFREENDK"
FT                   /protein_id="YP_173254.1"
FT   gene            complement(7803..8063)
FT                   /db_xref="GeneID:3200501"
FT                   /locus_tag="pBT9727_0012"
FT   CDS_pept        complement(7803..8063)
FT                   /locus_tag="pBT9727_0012"
FT                   /gene_family="HOG000034624" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899883"
FT                   /db_xref="GeneID:3200501"
FT                   /translation="MKVIDIADRRRVYFEMKQRELQCSILITLAGFVAAVVLLVYQIRF
FT                   EWGQLYHYICIMFLLVYFSFNLYSNNKLSKECSKINRYRQG"
FT                   /protein_id="YP_173255.1"
FT   gene            complement(8081..11446)
FT                   /db_xref="GeneID:3200474"
FT                   /locus_tag="pBT9727_0013"
FT   CDS_pept        complement(8081..11446)
FT                   /locus_tag="pBT9727_0013"
FT                   /gene_family="HOG000034625" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899884"
FT                   /db_xref="GeneID:3200474"
FT                   /translation="MAATKLKEWFLKSKRTLTIGVFTVLILISSFIFSPVTFADGWWDE
FT                   IVWKWDDVKKEEALVFLDNDWIQYGNILGMILQSLKGWIIQPLFAMVSSLEDLIPKTFS
FT                   FFDLLEDTGLNSFAASIMKGLFYALLLLVIVWLAIKTIIQHKPPRFKSVVVNIIVMIGL
FT                   IGGLNELMADMQKMATDFYEDTTNDSKAKEGLAFSIVRQNTADLAYLSTVGFGAIQIKD
FT                   SDQSASHFDERYPKNSLSKEMYMAADLGDIISPDVVDKLKDQDDVAEETKFLAYRVTNN
FT                   GVEEALESIEDSFFNPFKDTFPSGYIRYPMKFTTIFWGLASLGIAYLFTIFVFVMTIFE
FT                   IAMKKIIAPIVFVTDIETGEKTKMVIQDIAKGFMLIGFTGLSLRFYTIAVNFLAGKDIN
FT                   AFLYIVAMICLTGALIKGSDSILKYFGVDVGLKEGKNNLMAAVGMLAAANGARKGVSNM
FT                   FKSAKDKMGGQNKQTRDDTPKRSEMDAEDMENHQNEKEKGNKKSGITPKKFMKNTGAAL
FT                   SYASNRGVGGMMNDAGNLVAATVGGAVDKGKEKVTGVAKDVSDGVKGTIDEFKEGQAEG
FT                   KQKAQENNDRQLLNRMGKDIHKNANSGTEQSANPKVEDVSVGNKQQVERELEVANRINN
FT                   PGRNEVPNDQAKGDRQQVERELEVANRINNPGRNEVPNDQAKGDRQQVERELEVANRIN
FT                   NPGRNEVPNDQAKGDRQQVERELEVANRINNPGRNEVPNDQAKGDRQQVERELEVANRI
FT                   NNPGRNEVPNDQAKGDRQQVERELEVANRINNPGRNEIPNDQAKGDRQQIERQVEVANR
FT                   LNNTGSNEVPNTQAKGENQRVERQVEVANRLNNTGSNEVPNTQAKVENQQVERQVNVAD
FT                   RLNSVGASSVSQNNIKPEASTVQREVNIQDNVKNQGSVNSGNVSVNGTTVQREVNIQDN
FT                   VKNQGSVNSGNVSVNGTTVQREVNVQDNVKNQGSVNSGNVSVNGTTVQREVNVQDNVKN
FT                   QGSVNSGNVSVNGTTVQREVNVQDNVKNQGSVNSGNVSVNGTTVQREVNVQDNVRSQGT
FT                   VSSGNVSVNGTTVQREVNVQDNVKDQGTVSSGNVGVNGATVQREVHVQEKEVRASGLRQ
FT                   RGIKRNRTDQLRRN"
FT                   /protein_id="YP_173256.1"
FT   gene            complement(11481..14114)
FT                   /db_xref="GeneID:3200504"
FT                   /locus_tag="pBT9727_0014"
FT   CDS_pept        complement(11481..14114)
FT                   /locus_tag="pBT9727_0014"
FT                   /gene_family="HOG000107684" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="conjugation protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899885"
FT                   /db_xref="GeneID:3200504"
FT                   /translation="MRVGIGKLSLKRKKYLHHDYRIDGEDLPQEKNRINKKALAISSVA
FT                   VLFPIGAINFVAGSYQKIIKELSKTVEKPTVFDVVGSKWENSLSIKSVFLPALPTNMYL
FT                   FSLLASTLVGFLVYSKVNYRSDENVAYGQKGDSRFTTIEEIKEQYQEIPEKGEVFEGYG
FT                   GVPVSHYKDKYYIDQDTVNTAILGVSRSGKGEMIIVVMIDNLSRAKNQSSMVVNDPKGE
FT                   LYSASKETLEKRGYDVQVLNIDEPLQGMSYNPLQLVIDAWVNGDDQEAAKRANTLTFSL
FT                   YNDPNAGDNAFFNTSAQNAINGIILAIVDYCVKNNCIEKVTMHNVSQMLNELGTFYYKE
FT                   NPDDFVEKNALDEYFKSLPQGNVAKMQYGSTSFAGEKAKGSILATANQGLQTFADKMFA
FT                   KMTSKSSLDLKQVGFPKNLFFQLDERFLNKRVTVSFHKNDDKKTEIGSYKIKVKSLGMC
FT                   NMNFDDSLENGDLLLIRYQDEENPNKKYRLLYSLKFETLLDEKGKVVYQKKEGNEDKPE
FT                   YKQQVTLIKKANTFPLEPKVKLTYSEKPTAVFMIVPDYDKSNHVLASIFVKQLYTELSM
FT                   NCTDTKGKKCLRRVHFLLDEFGNMPAIDDMGGVLTVCAGRNMLFDLVLQSYSQIEKLYD
FT                   KQAKEIKQNCQNHIYIMSTDPETIEEISKRAGHKTIIGKSSNESHLDADNKVTKSADQQ
FT                   RIITPDRLSQFIEGETLVLRALHRQDINRKKVRAYPIFNTKETSMPYRWQFLAKDFDTS
FT                   RDLNEIDIPSLHTGLDLTDLYLNFLDFIVNPVAKREYMRKQSANAVVKKEITLDQVIKS
FT                   LIELVKEKRNIDDPKEIRTRLAKMLLNYAKNKVVPPIEEVEFLKEQSSVQEITRCLEKL
FT                   LKILAD"
FT                   /protein_id="YP_173257.1"
FT   misc_feature    complement(<12888..13571)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="pBT9727_0014"
FT   misc_feature    complement(order(13533..13541,13551..13556))
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="pBT9727_0014"
FT   misc_feature    complement(order(13458..13463,13467..13469,13533..13541,
FT                   13551..13553))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="pBT9727_0014"
FT   misc_feature    complement(12003..>12485)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="pBT9727_0014"
FT   misc_feature    complement(12330..12344)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="pBT9727_0014"
FT   gene            complement(14132..16171)
FT                   /db_xref="GeneID:3200454"
FT                   /locus_tag="pBT9727_0015"
FT   CDS_pept        complement(14132..16171)
FT                   /locus_tag="pBT9727_0015"
FT                   /gene_family="HOG000050190" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899886"
FT                   /db_xref="GeneID:3200454"
FT                   /translation="MLFNRKIYTWNEVKGMYIVEFLQKEQSKSFKRFLKKNKAWNGKQL
FT                   GLRTAESLIQKYVAENQQNDQILLLLQDIENEKAYEFALPVRASEKFSLLTTISNDLEE
FT                   GNTDFNLAMDIKQGLYTSYKAEEKQGSIEPEVQAPQKKKGGFLSKIFGKKEEEIPHAAT
FT                   VDTRDFDDEVQKEFAKDDPFEEMTDREMQQRGMDLFEVSDLEHLEKEAENLSEVNKEDI
FT                   FAIEEKEADQDKELNLEKENEELTFEVNGNESVKSIEEELFYPESENEKVEGNQEAHSL
FT                   IQAKDVNFPEYEKYIDLKEVETKQSRYDSRFTIKHLLGLMGMSEETSKTALENKRLQFV
FT                   KNVLSGKDFLIIQDNYYQDVNNLIDEIRLILERTYKETIMRDYQKEAEEKLRETFEANL
FT                   QERLQKLNAFENKENQEMQQKLNTFSEKQQLELQSFKLKQEAEFKVYESDLEERKLMLV
FT                   SAHEEELKAENDMEKEKSLHEKAYDLKLEANKLLIDKKNELLADFVGALEDIMNAASES
FT                   QESQLKDLQAYMNQLIPEWREEIQAEHDKEMENRKLKLEEEKNRLEQEALILEQRKQEA
FT                   LEMKTSARERELLNIIDELNDRVIKAYAGTGQMPQQPMYMYAPPMQPVQQPVQQPVYMY
FT                   QQQPVMQQQPMQPQAAQQPVMPSQPESNPEKRRNLFDFWYKNEK"
FT                   /protein_id="YP_173258.1"
FT   misc_feature    complement(<14552..>15019)
FT                   /note="Protein of unknown function (DUF3584); Region:
FT                   DUF3584; pfam12128"
FT                   /db_xref="CDD:152563"
FT                   /locus_tag="pBT9727_0015"
FT   gene            complement(16221..16502)
FT                   /db_xref="GeneID:3200488"
FT                   /locus_tag="pBT9727_0016"
FT   CDS_pept        complement(16221..16502)
FT                   /locus_tag="pBT9727_0016"
FT                   /gene_family="HOG000034626" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899887"
FT                   /db_xref="GeneID:3200488"
FT                   /translation="MDLFTAFYIKLLTYNDFFDSVSTAMGSWTGRLQAIGVGIIIFCVA
FT                   VAGVMYMLGEEMSRKAKQWLFRIIVGGVILFSAGIIGDTIRGLTGEDL"
FT                   /protein_id="YP_173259.1"
FT   misc_feature    complement(16248..>16451)
FT                   /note="TrbC/VIRB2 family; Region: TrbC; cl01583"
FT                   /db_xref="CDD:174649"
FT                   /locus_tag="pBT9727_0016"
FT   gene            complement(16565..16840)
FT                   /db_xref="GeneID:3200484"
FT                   /locus_tag="pBT9727_0017"
FT   CDS_pept        complement(16565..16840)
FT                   /locus_tag="pBT9727_0017"
FT                   /gene_family="HOG000034627" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899888"
FT                   /db_xref="GeneID:3200484"
FT                   /translation="MARKNPKNDKAPHQDAVTVILKKQGITYEEWSQKIVSDKCVSLLQ
FT                   GGEPEWRNKMLEEAAMVEIAAFIVKQENNRQLQSGSHSNSDIQSRA"
FT                   /protein_id="YP_173260.1"
FT   gene            complement(17025..17387)
FT                   /db_xref="GeneID:3200467"
FT                   /locus_tag="pBT9727_0018"
FT   CDS_pept        complement(17025..17387)
FT                   /locus_tag="pBT9727_0018"
FT                   /gene_family="HOG000034628" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899889"
FT                   /db_xref="GeneID:3200467"
FT                   /translation="MQESSIMEMVKWFLTLFSIVLLVAVAIFCIQLSNVNSYKQQVNYT
FT                   IERKGGLTKGAAQSLKEYSDKYYNGAFTIESEKLNEKVQYGEIVDYQVVAKFKIAVFNI
FT                   PDVTMKFTGSASSQIR"
FT                   /protein_id="YP_173261.1"
FT   gene            complement(17443..18189)
FT                   /db_xref="GeneID:3200457"
FT                   /locus_tag="pBT9727_0019"
FT   CDS_pept        complement(17443..18189)
FT                   /locus_tag="pBT9727_0019"
FT                   /gene_family="HOG000034629" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899890"
FT                   /db_xref="GeneID:3200457"
FT                   /translation="MRVVATTSAKKNRYKRLFAEEELYNMLQEMGNTRQMIDNFQTKRI
FT                   KQTLMMVVIAFFMGLLVSKWCYLLAIVLPILFYRSKYKKVVRTYNAFKFERHLNFIKFM
FT                   RLLIPYLKEGEGGTSLYQILRKILKRTENPVDANSVAKLMSELTDKPNDIQPFTDFAMR
FT                   SSGTDMSILFMQTIYDFQQNSYDTNVIDELGKIASAALQRSIDEIVTFKLKRFTFFPTK
FT                   IVMSAFLIVVGFAAAILRYNLSSINL"
FT                   /protein_id="YP_173262.1"
FT   gene            complement(18186..19019)
FT                   /db_xref="GeneID:3200509"
FT                   /locus_tag="pBT9727_0020"
FT   CDS_pept        complement(18186..19019)
FT                   /locus_tag="pBT9727_0020"
FT                   /gene_family="HOG000011014" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899891"
FT                   /db_xref="GeneID:3200509"
FT                   /translation="MKVSTFNAKTRKKKFVNADEINAIKVAYGKPLERKDYLRYGLIPG
FT                   LIVGGFSFILLYLWWVSLILGIIGALYGLKVLMPKIIQRTYEQISFRERNKFVNNMTQI
FT                   LTNDSQTLLKALGRASDRSEGELKKDLKVLQAKLMGADHGQVLQAFKVISNKYRDDIIF
FT                   VQYIEQIETASLEGKTNMDTLKDIKSYHNEMKEKKEEYDRKKDGHLRDIKSLCIIVVFF
FT                   ILIIAFSFNFETYIDAFARHPIGWCTAGIYMLLMFFFSRSFANYYFDDSILEVKI"
FT                   /protein_id="YP_173263.1"
FT   gene            complement(19054..20385)
FT                   /db_xref="GeneID:3200529"
FT                   /locus_tag="pBT9727_0021"
FT   CDS_pept        complement(19054..20385)
FT                   /locus_tag="pBT9727_0021"
FT                   /gene_family="HOG000011013" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="secretory protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899892"
FT                   /db_xref="GeneID:3200529"
FT                   /translation="MRMLGISKTKITQKKKDKFKFNPDNLQRIKEDLNTKHAELVIDAL
FT                   LNEGSRKKIKETIQNDYPYMFMDYDDDEDIAEYVVSEIIGTGVIERIIKERPDITDISY
FT                   NGSHLIVESSDYKGSYENSDHIISEEYISRVIQKFANAVGTEFVPKKPIFDGVYGSIRI
FT                   NAVHNQNTVGNSTMSLRIVRPRLALNEENFATFAPEFMLEFFKVLMVSRNNILISGETG
FT                   TGKTEFLKLLFSYILFEHKAVMIEDVPETHVKQLFPDKDVLSWLTGHGVTVTDLIKAAL
FT                   RNNPRWIMISELRGKETYEAIQAVLSGHHVVTSLHSVDAETSPKRLVNMSKIGYQVDEK
FT                   SLEEDIMRYFGFGCHIKRVVIKTTGENGVKINRVIRYLSKVVEYSHEGCKMVFEQKYSN
FT                   GKFTYSTGSLSEGFYERLAEADLKYDLPKYTDVLAVKEGLVATR"
FT                   /protein_id="YP_173264.1"
FT   misc_feature    complement(19378..19815)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="pBT9727_0021"
FT   misc_feature    complement(order(19708..19716,19726..19731))
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="pBT9727_0021"
FT   misc_feature    complement(order(19510..19515,19645..19650,19654..19656,
FT                   19708..19716,19726..19728))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="pBT9727_0021"
FT   misc_feature    complement(19513..19527)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="pBT9727_0021"
FT   gene            complement(20403..20786)
FT                   /db_xref="GeneID:3200515"
FT                   /locus_tag="pBT9727_0022"
FT   CDS_pept        complement(20403..20786)
FT                   /locus_tag="pBT9727_0022"
FT                   /gene_family="HOG000034630" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899893"
FT                   /db_xref="GeneID:3200515"
FT                   /translation="MKDYPFVLLMLIIGFFMVVISGYYYKQNFTTDSVMQGITETIRAS
FT                   AVANADNSSRIQNGELYVSKQDFEKDFKKRINSNNLVKIKKDAKYEFKYLDNKNGSIKA
FT                   IRVIIQDGNNTFQATCKVNIATS"
FT                   /protein_id="YP_173265.1"
FT   gene            complement(21140..21514)
FT                   /db_xref="GeneID:3200523"
FT                   /locus_tag="pBT9727_0023"
FT   CDS_pept        complement(21140..21514)
FT                   /locus_tag="pBT9727_0023"
FT                   /gene_family="HOG000034632" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899894"
FT                   /db_xref="GeneID:3200523"
FT                   /translation="MNVLTYNSAKKQIIFMALYFVITGIVIRLIGYSLEGSLSALTQAG
FT                   VDNLLSGNLSFGDMFHFDFSFDTSQFDGFSFNTLVVFVKEKIESVINDMMPTTLGAINM
FT                   LMLNKYFTIDRAIKLGIKLY"
FT                   /protein_id="YP_173266.1"
FT   gene            complement(21534..25814)
FT                   /db_xref="GeneID:3200496"
FT                   /locus_tag="pBT9727_0024"
FT   CDS_pept        complement(21534..25814)
FT                   /locus_tag="pBT9727_0024"
FT                   /gene_family="HOG000139084" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="fusion protein (includes pXO2-28-29-30)"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899895"
FT                   /db_xref="GeneID:3200496"
FT                   /translation="MVVKRGGIRLWFRRSFSLLFVVMLLFGSLADFVSIGHAESTSDQK
FT                   QAQENKTNDVTVLQEKSDLKSTGTNPNEVVVAKGKKGSELFDFEAFIKPSDIVDGTAPF
FT                   DSNDEAGNDSSPNNGIVRTFDTVTYPLKVTINPKKNETLKNIKMKITGTLENGITNKRV
FT                   NAKFAVGGKEDLEKGIVSFDMEYTLKETGNSLMIPVTLEIQGAEQGLKLKPNIKIQVIS
FT                   VDGKDIQDENVSQSFDDISPVTTSGKVNVKARFTASYGGMPRLDYKVYDPNAKEDDRTI
FT                   IYPVALDLFINNLPNRTDLRGATFPVGKINYHFNFSGKVDWDNKSLGAETLNFEGRDKP
FT                   MKIFNYQAIDKIVDKVPQEGTESFEIGMKGYKDTRTEVANSPKSYIPRDKWNASDIDKY
FT                   TIDSVWDSGTVRLNKPEITKDHVGYTGSIEDYVIGSTFPTMMSRPGSPTIPTFGKNEKA
FT                   FSSTRFLIHSTNEYYPFGKNNKENLPNNVYYYLEFVIDSYEDSKGNTIPYNTVGKYTLT
FT                   ERNNPKGSYSIQTTFHTTDHKELGTPHVGYSVVSKGDPTVIVGQKVKLISHLNVRAVTE
FT                   GGTTMVYKWNTDSFYLTKGSAEIARKDMLNQGYPNTSGGRIKDSDKQKIYFGISKKEDN
FT                   SFETLTQNKDEDYNWYSTYDEARKNGEVGAIKNDINASMGDGEVVAWNIPLEVKTKKIG
FT                   SVNEKGTPNITVTDSVVYPSADRKVGYRVRGEGKYNNFTEYDEKGNITKLQSPVGSTVN
FT                   FETLGIMNGETSSDVKTNKNTYYSSDNVSVTVDNLVKLPDAMDYNSLDEKVEMRVKIPK
FT                   GLDYVVGSAKYGDQYIEPKIEQQNDGSNHLIWHDTLTRGNKTLKKINFETRINPVLLPQ
FT                   GNQVGLEIKNVLSSAMDTRAEKFRTSSKNISVVKIGMVGVSETIEKVTGKKNSDYVVGV
FT                   QPYTTIKDESHIKALTYVPRNKDHNGSAFNGVTFLKQIALENANNKNVEIWLNNSFVES
FT                   NNPNKIDLNSNGWYRYTGEQDLSKVVSILLYINDSLSSSDIVKMNLVYGTNKNEFGDFY
FT                   VSKTVVNTSVDYKLSPVSNQVKYTIVADANLGLRKIRIDTAPTDIGLPVIVRLDKDIIY
FT                   EDSNKSNVAVNLYDKADNKLVDSKVYTIEELPEEIKFKVDPKFLKKHDKRNYEVRFEKV
FT                   NKESILILDGKGKVDTDGYTSSEETVKANAKASTELKYKGVIMTEREVGKEMEIFYETL
FT                   TIPLKQLPKQKTGYGFELKPLVSYNNELAVPYDVKANAFVDKRLIDSHLNYEKKGDQMV
FT                   VPLEEAEKTGSTDKKNTDFLFELPHINVEQKTGNLFTDQQVKDHDPRIKNAIKDGKRKL
FT                   YVPIWADLGEYNVLIASGIPIGANKVNFEVTQPLNLYAYMYGTIGSKTLKDDELLLEPV
FT                   DPKNPFSNGKPPGWSDEDVAWLKQ"
FT                   /protein_id="YP_173267.1"
FT   gene            complement(25972..26193)
FT                   /db_xref="GeneID:3200508"
FT                   /locus_tag="pBT9727_0025"
FT   CDS_pept        complement(25972..26193)
FT                   /locus_tag="pBT9727_0025"
FT                   /gene_family="HOG000080537" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899896"
FT                   /db_xref="GeneID:3200508"
FT                   /translation="MSVYIEGIHEDYTYGFLFYSKNKRIVLDDGVQEYPIDAAEVLLEK
FT                   EFVFIDELRKLDPLKIPGLRARIKVQAS"
FT                   /protein_id="YP_173268.1"
FT   gene            complement(26311..26769)
FT                   /db_xref="GeneID:3200505"
FT                   /locus_tag="pBT9727_0026"
FT   CDS_pept        complement(26311..26769)
FT                   /locus_tag="pBT9727_0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899897"
FT                   /db_xref="GeneID:3200505"
FT                   /translation="MSSMDSQTKKNTRSIKGLIKSIGMITLVVGFIVFLGICINYYMDK
FT                   TNKMDATKSEQTQENIKIAEKMIEKELNISSKYFKIVGIQKYLLGQVEVELNANTEDFW
FT                   IEKDLTCKVQVNGENYSLIFETQEVDSKNEELEMYEPVKINKIIKEQK"
FT                   /protein_id="YP_173269.1"
FT   gene            complement(27142..27543)
FT                   /db_xref="GeneID:3200500"
FT                   /locus_tag="pBT9727_0027"
FT   CDS_pept        complement(27142..27543)
FT                   /locus_tag="pBT9727_0027"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899898"
FT                   /db_xref="GeneID:3200500"
FT                   /translation="MNKKKALISLAYAMALYSLVGCSNSTNTGTMAAEKEKAATSENKE
FT                   VTNTEENYELGEIKITNKERNKESRIEVVEAHIVDDGKQGLDPRNTALQEVIILHDKVQ
FT                   DCNYLYTYSSSSTGSGSATMKKLECGKKE"
FT                   /protein_id="YP_173270.1"
FT   gene            complement(27729..28475)
FT                   /db_xref="GeneID:3200514"
FT                   /locus_tag="pBT9727_0028"
FT   CDS_pept        complement(27729..28475)
FT                   /locus_tag="pBT9727_0028"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899899"
FT                   /db_xref="GeneID:3200514"
FT                   /translation="MLSCSKCSNTKSVKGVDVLNAAGMEYKIDKLKREINDTWKSLWML
FT                   SVYTLLMWILEPMMEEIMQLGGEENKLLTTISKMFFDYILVVVFWIVYIIGLIVIFKKK
FT                   RTIKRYRKAKDDPPKINMQKDDINQNPVYVIDHSKDKPNQYEKGDKDMMKRVFNQNKNV
FT                   STNSGKQNTNRTRGKGSSTRSYNGSTRSSNSMPSDNSALDIALGSSIYSTGNDNDCSSS
FT                   SSSNYSSPSSDYSSGSSGYDGGSSCD"
FT                   /protein_id="YP_173271.1"
FT   gene            complement(28436..28660)
FT                   /db_xref="GeneID:3200520"
FT                   /locus_tag="pBT9727_0029"
FT   CDS_pept        complement(28436..28660)
FT                   /locus_tag="pBT9727_0029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899900"
FT                   /db_xref="GeneID:3200520"
FT                   /translation="MSKEVTIKITETGWKLKAEVNGNVYEEEAVMKEPGDALHVKGDLE
FT                   ENLWMNDKLHETLGSHFCFRVANALIQSQ"
FT                   /protein_id="YP_173272.1"
FT   gene            complement(28638..29093)
FT                   /db_xref="GeneID:3200531"
FT                   /locus_tag="pBT9727_0030"
FT   CDS_pept        complement(28638..29093)
FT                   /locus_tag="pBT9727_0030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899901"
FT                   /db_xref="GeneID:3200531"
FT                   /translation="MLFNSIVINILIFLFFLSVFTFYTGLELSKNWRIIMALIMIGSLI
FT                   GLIVCGYFRIVEMSEENKLKTEMAAERIEYNEKKKNELLTEKFKLPITDILIEPVLETK
FT                   YYKVTTNTGIYKLSFAYDTNDKIIGFKEFKQITSISQEGNHEQGSHN"
FT                   /protein_id="YP_173273.1"
FT   gene            complement(29397..29966)
FT                   /db_xref="GeneID:3200490"
FT                   /locus_tag="pBT9727_0031"
FT   CDS_pept        complement(29397..29966)
FT                   /locus_tag="pBT9727_0031"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899902"
FT                   /db_xref="GeneID:3200490"
FT                   /translation="MIALVKEPLITESELTGLKHKLDNEKQMVLEIYKIAFENFLRRKF
FT                   TSEFLINEIRKQMNNGFDNLPIKLVNCDIIDYRSSYNFRYMIGETFSNSFCWLFFNRIV
FT                   IKRKFWKYRKVVKKIAEPFREDEIIQLSMEEIAEEVIYKSEFFQKIIKDLEKASIRVGG
FT                   GIHSRPGEKVFILLLKWGEGNETNEE"
FT                   /protein_id="YP_173274.1"
FT   gene            complement(30036..30455)
FT                   /db_xref="GeneID:3200487"
FT                   /locus_tag="pBT9727_0032"
FT   CDS_pept        complement(30036..30455)
FT                   /locus_tag="pBT9727_0032"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899903"
FT                   /db_xref="GeneID:3200487"
FT                   /translation="MQNVFKKKKIDPIEFLVFGKKDFDKLPIEICLYALEKIKQHQEFV
FT                   AVKIDIGILGRKTNINTTEIKINALNKKEWIVCFGEYDVFLYDNFIANTPVNFKWINEK
FT                   KFEVKFSQKISDASNIYVKFYGDIGNLTKEDYFAG"
FT                   /protein_id="YP_173275.1"
FT   gene            complement(30605..30862)
FT                   /db_xref="GeneID:3200475"
FT                   /locus_tag="pBT9727_0033"
FT   CDS_pept        complement(30605..30862)
FT                   /locus_tag="pBT9727_0033"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899904"
FT                   /db_xref="GeneID:3200475"
FT                   /translation="MEVKVMSIVATFHFVSGLRRSTIVNAESEEKASIIINTKFFQGVG
FT                   HAIFELMRKENKDEFEENGDKVEQFEVFRDHVMFIDYEVQ"
FT                   /protein_id="YP_173276.1"
FT   gene            complement(31559..32044)
FT                   /db_xref="GeneID:3200497"
FT                   /locus_tag="pBT9727_0034"
FT   CDS_pept        complement(31559..32044)
FT                   /locus_tag="pBT9727_0034"
FT                   /gene_family="HOG000034634" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899905"
FT                   /db_xref="GeneID:3200497"
FT                   /translation="MFKNKSMKLFPVLLAFVIMIFTGCSSDNSMEFKKGENYKRTDRSL
FT                   FVEVQDDNEWKMHKGSDRADKYAVYKLEKTEYKAGKYAVFTISLKEKFGSDPLLLSNGD
FT                   EKLIVSPTENGFSTKRVGMNSGDDWENFQKDFKAADDKEAFLKKLSEDKAKKYEKVN"
FT                   /protein_id="YP_173277.1"
FT   gene            complement(32144..32353)
FT                   /db_xref="GeneID:3200481"
FT                   /locus_tag="pBT9727_0035"
FT   CDS_pept        complement(32144..32353)
FT                   /locus_tag="pBT9727_0035"
FT                   /gene_family="HOG000034635" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899906"
FT                   /db_xref="GeneID:3200481"
FT                   /translation="MGVSELNFNEKAKKILRSKSISVGLFDLDERYSLGKKINVFCNSM
FT                   NAIYTFTVINITLVRKTHWVVHLK"
FT                   /protein_id="YP_173278.1"
FT   gene            complement(32344..32877)
FT                   /db_xref="GeneID:3200516"
FT                   /locus_tag="pBT9727_0036"
FT   CDS_pept        complement(32344..32877)
FT                   /locus_tag="pBT9727_0036"
FT                   /gene_family="HOG000034636" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899907"
FT                   /db_xref="GeneID:3200516"
FT                   /translation="MGKEHRERYVKKIAGVITAKRKYPTGYLVVGEYDLSLEFQKEMVD
FT                   VLDHNEVVSCHLDFNKYDSETDCIVALKRAKKQLGESRESGKMLILVITAFDRLTKKYM
FT                   DAVKQLIGCKDIGINLLISANIPLVHIVGLTEYMITFDSAAKVLSEFYRYNTQQVICSL
FT                   YNETLARKSSRAWG"
FT                   /protein_id="YP_173279.1"
FT   gene            complement(33494..33799)
FT                   /db_xref="GeneID:3200478"
FT                   /locus_tag="pBT9727_0037"
FT   CDS_pept        complement(33494..33799)
FT                   /locus_tag="pBT9727_0037"
FT                   /gene_family="HOG000034637" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="GI:56899908"
FT                   /db_xref="GeneID:3200478"
FT                   /translation="MFMRAKEFSKKTHSLKVVQEMDTGSLVRKAHSISTFQGQEYIVLD
FT                   NGNLYDPLKKREVPLARIFRYIKCVRNSYGVIIAKKSNTSAKLMEVKFIKKSKQVS"
FT                   /protein_id="YP_173280.1"
FT   gene            complement(34833..36101)
FT                   /db_xref="GeneID:3200507"
FT                   /locus_tag="pBT9727_0038"
FT   CDS_pept        complement(34833..36101)
FT                   /locus_tag="pBT9727_0038"
FT                   /gene_family="HOG000156795" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899909"
FT                   /db_xref="GeneID:3200507"
FT                   /translation="MIGTKSLCSRRGAIVMDYKAKTEDEESKKIFNSFLSTLINDIDFQ
FT                   KRNQEDIAKEIGITPGTFSKNLSGKNQFGFWKLIKLLDILYENDINKKRKMLCAFCSVT
FT                   TSKKNLRIAMEYANAKGDLLLLKFIVDQEKNSSLAMNREWAYVYELVWQRSSGAIAKQE
FT                   LLDKLEDRKGSKVIKTKEMKILYGILTCYTMCDLETYTSLFEYADVLLPKVDDISDSFI
FT                   KTAYLGRIKECLSFAYLVQDKLENLRNTCHEILELEDPESCFNLLRASALVYLAESFTF
FT                   ECYDSASKYIKESLEQLEPYYFEREKQRRQEILNTYAFIKLVNKKELDKIKIYHPAEES
FT                   FLEIIKGNYKNAVTILNDLEKKNGFLTPMQYCYLGIAKNDITLIEKAIELFECAGNRFY
FT                   CKFPKKMVVEFNKNGIIYEGGAI"
FT                   /protein_id="YP_173281.1"
FT   gene            complement(36561..36872)
FT                   /db_xref="GeneID:3200491"
FT                   /locus_tag="pBT9727_0039"
FT   CDS_pept        complement(36561..36872)
FT                   /locus_tag="pBT9727_0039"
FT                   /gene_family="HOG000217614" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899910"
FT                   /db_xref="GeneID:3200491"
FT                   /translation="MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGG
FT                   RAGSYESKLKEARDIAMDEMKELAKQKGANAIVGVDVDYEVVRDGMLMVAVSGTAVRI"
FT                   /protein_id="YP_173282.1"
FT   misc_feature    complement(36564..36872)
FT                   /note="Domain of unknown function (DUF74); Region: DUF74;
FT                   cl00426"
FT                   /db_xref="CDD:174196"
FT                   /locus_tag="pBT9727_0039"
FT   gene            complement(36936..37586)
FT                   /db_xref="GeneID:3200506"
FT                   /locus_tag="pBT9727_0040"
FT   CDS_pept        complement(36936..37586)
FT                   /locus_tag="pBT9727_0040"
FT                   /gene_family="HOG000094545" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899951"
FT                   /db_xref="GeneID:3200506"
FT                   /translation="MSFIKTNTKELVMLIIYILFALLQIGLFILFGISLLTNSNLVESE
FT                   FALSAIGLTVPAIVGIIFFRKEIIESFTYFKEKTILKIVSIPMVVLLMIIVENSIMHFL
FT                   NTGQPENQEQILTNGAEMPIIFTLLVFGIIGPIIEEIIFRYILVNRFSEYVGTAIASIV
FT                   SIIIFTLLHTNQLSDIAIYLPGTVMLTAAYLISNRSLAYVIAIHMLNNFIPFI"
FT                   /protein_id="YP_173283.1"
FT   gene            37850..38323
FT                   /db_xref="GeneID:3200494"
FT                   /locus_tag="pBT9727_0041"
FT   CDS_pept        37850..38323
FT                   /locus_tag="pBT9727_0041"
FT                   /gene_family="HOG000064200" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899911"
FT                   /db_xref="GeneID:3200494"
FT                   /translation="MYIMILVSSCLAGKPVRYNGTACLNDTIQKLIDEKKAIPVCPELL
FT                   GGFVTPREPAEILGGDGYDVLEGKAKVMERSGNDVTELYINGAMKTLNLAQEMQASHVV
FT                   LKEYSPSCGSKEIYSGEFVGKKVTGVGVTTALLESKGIKVISELELDKLINKI"
FT                   /protein_id="YP_173284.1"
FT   misc_feature    37856..38302
FT                   /note="Protein of unknown function (DUF523); Region:
FT                   DUF523; cl00733"
FT                   /db_xref="CDD:153961"
FT                   /locus_tag="pBT9727_0041"
FT   gene            38703..39293
FT                   /db_xref="GeneID:3200472"
FT                   /locus_tag="pBT9727_0042"
FT   CDS_pept        38703..39293
FT                   /locus_tag="pBT9727_0042"
FT                   /gene_family="HOG000161263" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:56899912"
FT                   /db_xref="GeneID:3200472"
FT                   /translation="MTKVDKVKEKIIETSLYFFNTNGITRTSIQDIMTATELPKGSIYR
FT                   RFKNKEEIVLAAYDKSGEIMWNHFHKAMENKKTAIDKILAIFLVYQDAANNPPIAGGCP
FT                   LLNSAIESTGVFPELQKAAAQGYDDTVMLMASLIKGGIEKQELKEDIDIISLASFLASS
FT                   MEGAIMASRVSNDNIHHQYFIEQIKYHLYSYSK"
FT                   /protein_id="YP_173285.1"
FT   misc_feature    38715..39215
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="pBT9727_0042"
FT   misc_feature    38733..38873
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="pBT9727_0042"
FT   gene            39718..41160
FT                   /db_xref="GeneID:3200479"
FT                   /locus_tag="pBT9727_0043"