(data stored in ACNUC1829 zone)

EMBL: BC003482.TSPAN4

BC003482.TSPAN4      Location/Qualifiers
FT   CDS_pept        60..776
FT                   /codon_start=1
FT                   /gene="Tspan4"
FT                   /product="Tspan4 protein"
FT                   /db_xref="GOA:Q9DCK3"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1928097"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DCK3"
FT                   /protein_id="AAH03482.1"
FT                   /translation="MARGCLQGVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGNFATLS
FT                   SSFPSLSAANLLIVTGTFVMAIGFVGCIGALKENKCLLLTFFVLLLLVFLLEATIAVLF
FT                   FAYSDKIDSYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNAT
FT                   RVPDSCCLEFSDSCGLHEPGTWWKSPCYETVKAWLQENLLAVGIFGLCTALVQILGLTF
FT                   AMTMYCQVVKADTYCA"
     atggcgcgcg gctgcctcca gggcgtcaag tacctcatgt tcgccttcaa tctgctcttc        60
     tggctgggtg gctgtggtgt cctgggtgtt ggcatctggt tggctgccac acagggaaac       120
     tttgccacct tatcatcctc atttccatcc ttgtcggctg ccaacctgct catcgtcacc       180
     gggaccttcg tcatggccat cggcttcgtg ggctgcattg gggccctcaa ggagaacaag       240
     tgcctactgc tcactttctt tgtgctgctg ctgctagtgt tcctgctgga agccaccatt       300
     gctgtgctct tctttgccta cagtgacaag attgacagtt atgcccaaca agacctgaag       360
     aagggcctgc atctgtatgg cacacagggc aacgtgggcc tcaccaatgc ctggagcatc       420
     atccagactg atttccgatg ctgtggagtt tccaattaca ctgattggtt tgaggtatac       480
     aatgccactc gtgtgcctga ctcctgctgt ctggagttca gtgatagctg tgggttacat       540
     gaacctggta cctggtggaa gtcgccctgt tatgagacag tgaaggcctg gctccaggag       600
     aacctgctag ctgtgggcat ctttggactg tgcacggcac tggtgcagat tctgggcctc       660
     accttcgcta tgaccatgta ctgccaggtg gtaaaggcgg acacctactg tgcatag          717
//

If you have problems or comments...

PBIL Back to PBIL home page