(data stored in ACNUC22857 zone)

EMBL: BC063350.AP2B1

BC063350.AP2B1       Location/Qualifiers
FT   CDS_pept        218..3073
FT                   /codon_start=1
FT                   /gene="ap2b1"
FT                   /product="adaptor-related protein complex 2, beta 1
FT                   subunit"
FT                   /db_xref="GOA:Q6P4L7"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P4L7"
FT                   /protein_id="AAH63350.1"
FT                   /translation="MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGK
FT                   DVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLD
FT                   SLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFI
FT                   LDCLSNYNPKDEREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYTMLL
FT                   KKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARGAMIWIVGEYAER
FT                   IDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHK
FT                   PPNAFVEGSHGVHRKHLPIQHGSIDIGDSPVGPTPSAGLEQPQVIPSQGDLLGDLLNLD
FT                   LGPPGNVPQVSTMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQTFIPSSVPATFAPS
FT                   PTPAVVSSGLNDLFELSSGIGMAPGGYVSQKAVWLPAVKAKGLEISGTFSHRQAHIYMD
FT                   MSFTNKALQHMTDFAIQFNKNSFGVIPSAPLAIHTPLMPNQSIDISLPLNTLGPVMKME
FT                   PLNNLQVAVKNNIDVFYFSCLIPLHVLFVEDGKMERQVFLATWKDIPNENELQFQIKDC
FT                   HLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSL
FT                   KCRAPEVCNYVYQVYDSILKN"
     atgacggatt caaagtattt tacaactaac aaaaaagggg agatctttga gctgaaagct        60
     gaacttaaca atgagaagaa agagaaacgg aaggaagctg tgaagaaggt tattgctgca       120
     atgaccgtgg gcaaagatgt cagctccctg tttccagatg tggtgaactg catgcaaaca       180
     gacaatctgg aactgaagaa acttgtttac ctttacctga tgaactatgc taaaagccaa       240
     ccagacatgg caatcatggc tgttaacagc tttgtcaagg actgtgagga tccaaaccct       300
     ctgatccgag ccctggcagt gcgtaccatg ggttgtatcc gagttgataa aatcacagag       360
     tacctttgtg agcctttgcg gaagtgcctg aaggatgagg acccatacgt gcgcaagaca       420
     gcagcagtgt gtgtggccaa actccatgat atcaatgccc agatggtgga agatcagggc       480
     ttcttagatt cactgaggga tctgattgct gattccaacc caatggtggt agccaatgca       540
     gtagctgcac tgtcagagat cagcgagtca cacccaaaca gtaatctgtt ggacctgaat       600
     ccccagaaca tcaacaaact gctgactgct ctgaatgaat gcactgagtg gggccagatc       660
     ttcatcttgg actgtttatc taattataat cctaaggatg agagggaggc gcagagtatc       720
     tgtgaacgtg tcactcctcg gttgtctcat gccaactctg ctgtggtgct gtctgctgtc       780
     aaagtcttaa tgaaattcct agagttgctg cctaaagact ctgattacta tactatgctg       840
     ttgaaaaaac tggctccccc tttggttact ttgctgtctg gcgagcctga ggtgcagtat       900
     gtagcacttc ggaacatcaa ccttattgta cagaaaagac ctgaaattct aaaacaagaa       960
     attaaagttt tctttgtaaa gtacaatgat ccgatttatg tcaaactgga gaaactggat      1020
     ataatgattc gcctggcatc acaggctaac attgctcagg tcttggctga gctgaaggaa      1080
     tatgccacag aggtggatgt tgattttgtt agaaaggctg ttcgtgccat aggacgctgt      1140
     gccattaaag ttgagcaatc tgcagagcgc tgtgtgagca ctctcttgga cctcatccag      1200
     accaaggtta actacgttgt tcaagaagcc attgttgtca tcagagacat cttccgcaag      1260
     tatcctaaca agtatgaaag tataattgcc acactgtgtg agaatctgga ttccttggat      1320
     gagccagatg cccgtggtgc catgatctgg attgttggtg aatatgcaga acgtattgac      1380
     aatgctgatg aactactgga gagcttcttg gagggatttc acgatgagag tacacaggtt      1440
     caacttactc tacttacggc tattgtcaaa ctctttctga agaagccatc agaaacccaa      1500
     gagctggttc aacaagttct cagcctggct acacaggatt ctgataaccc agacctgcga      1560
     gacagaggct atatttactg gcgattgctc tctactgatc cagtaactgc caaagaagtt      1620
     gtgctttcag agaagccact gatatctgaa gagacagacc taattgaacc cactcttctg      1680
     gatgaattaa tttgccatat tggctcactg gcgtcggtct accacaagcc acctaacgcc      1740
     tttgtggaag ggagtcatgg agtgcatcgc aagcaccttc caattcagca tggaagcatt      1800
     gatattggag acagccctgt tggtcccact ccatctgctg ggctcgaaca gccccaggtt      1860
     attccatcac aaggtgacct ccttggagat cttcttaatc tcgatctggg ccctccagga      1920
     aatgtgccac aagtgtccac catgcagatg ggagcagtgg accttcttgg tggaggtctg      1980
     gatagcttgc tgggaagtga ccttggtggc ggcattggtg ggagtccagc ggttgggcaa      2040
     accttcattc cctcctccgt tccagcaaca tttgctccgt cccctacacc agcggtggtt      2100
     agcagtggac tgaatgattt gtttgaactg tcttctggta ttgggatggc gcctggagga      2160
     tatgtatcac aaaaagctgt ctggttacct gctgtaaaag ccaaaggctt ggagatctct      2220
     ggtacattct cccacaggca agcacacatc tacatggata tgagtttcac caacaaagct      2280
     ttgcagcaca tgactgactt tgcaatacag tttaataaga acagctttgg tgtcattccc      2340
     agtgcccctc tggcgattca tactcccctc atgcccaacc aaagtattga catttctctt      2400
     cctctaaaca cccttgggcc tgttatgaaa atggagcccc ttaacaatct ccaggtggct      2460
     gtgaaaaata acatcgacgt gttctacttc agttgtctta tccctctaca tgtgctcttt      2520
     gtggaggatg gcaaaatgga acgtcaagtc ttcctggcca catggaagga catccccaat      2580
     gagaatgagc tgcagtttca gatcaaagat tgccatttga atgcagacac agtttccagc      2640
     aagcttcaga ataacaatgt ttataccatt gccaagcgga atgtggaagg gcaggacatg      2700
     ctgtaccaat ccctcaaact taccaatggt atctggattc tagcagagct gaggatccag      2760
     cctggaaatc ccaattatac gctttccttg aagtgccgtg caccagaggt ctgtaactat      2820
     gtttaccaag tgtatgactc tatactgaag aactga                                2856
//

If you have problems or comments...

PBIL Back to PBIL home page