(data stored in ACNUC27125 zone)

EMBL: BC065500.FAM21A

BC065500.FAM21A      Location/Qualifiers
FT   CDS_pept        <1..382
FT                   /codon_start=2
FT                   /gene="FAM21A"
FT                   /product="FAM21A protein"
FT                   /db_xref="H-InvDB:HIT000261908.13"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P0Q7"
FT                   /protein_id="AAH65500.1"
FT                   /translation="KNETKSNSQQDVILTTQDIFEDDIFATEAIKPSQKTREKEKTLES
FT                   NLFDDNIDIFADLTVKPKEKSKKKVEAKSIFDDDMDDIFSSGIQAKTTKPKSRSAQAAP
FT                   EPRFEHKVSNIFDDPLNAFGGQ"
     gaagaatgag acaaaatcca atagtcagca ggatgtcata ttaacaacac aagatatttt        60
     tgaggatgat atatttgcta cggaagcaat taaaccctct cagaaaacca gagagaagga       120
     gaaaacattg gaatctaatt tatttgatga taacattgat atctttgctg acttaactgt       180
     aaaaccaaaa gaaaagtcca aaaagaaagt ggaagccaag tctatatttg atgatgatat       240
     ggatgacatc ttctcctctg gtatccaggc taagacaacc aaaccaaaaa gccgatctgc       300
     acaggccgca cctgaaccaa gatttgaaca caaggtgtcc aacatctttg atgatcccct       360
     gaatgccttt ggaggccagt ag                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page