(data stored in ACNUC22857 zone)

EMBL: BC066566.AP2B1

BC066566.AP2B1       Location/Qualifiers
FT   CDS_pept        119..2974
FT                   /codon_start=1
FT                   /gene="ap2b1"
FT                   /product="adaptor-related protein complex 2, beta 1
FT                   subunit"
FT                   /db_xref="GOA:Q6NYJ9"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NYJ9"
FT                   /db_xref="ZFIN:ZDB-GENE-030131-6564"
FT                   /protein_id="AAH66566.1"
FT                   /translation="MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGK
FT                   DVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLD
FT                   SLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFI
FT                   LDCLSNYNPKDEREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNTLL
FT                   KKLSPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASHANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARGAMIWIVGEYAER
FT                   IDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHK
FT                   PPNAFVEGSHGIHRKHLPIQHGSIDTGESPVSTGPAASIDQPQVIPSQGDLLGDLLNLD
FT                   LGPPVNVPQVSSMQIAAVDLLGGGLDSLLGGDLGGGVGGSPAVGQNFIPSSVPNTFAPS
FT                   PTPAALSSGLNDLFELSTGMATATGGYVAAKTVWLPAVKAKGLEISGTFSRRQGHMYMD
FT                   MTFTNKALQHMTDFAIQFNKNSFGVIPTTPLPVHTPLMPSQSIDISLPLNTIGPVMKMD
FT                   PLNNLQVAVKNNIDVFYFSTLIPLNVFFVEDGKMERQVFLATWKDIPNENELQYQIKDC
FT                   HLNADTVSGKLQSNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSL
FT                   KCRAPEVSQYVYQMYDATLKN"
     atgactgact caaagtattt caccaccaac aaaaaaggag aaatctttga gctgaaggcc        60
     gagctgaata atgagaagaa ggagaagagg aaagaggcag tgaagaaagt catcgccgcc       120
     atgacggtgg gcaaggatgt cagttcgttg tttccagatg tggtgaactg catgcagacg       180
     gacaacctgg agctgaagaa gctggtttac ctgtacctta tgaattatgc caagagtcag       240
     ccggacatgg ccatcatggc agttaacagc tttgtcaagg actgtgagga tccaaaccct       300
     ctgatccgtg ctctggctgt gcgcacgatg ggttgtatcc gcgtggacaa gatcactgag       360
     tacctctgtg aacctctgcg aaagtgtctg aaggatgaag acccgtacgt gaggaagact       420
     gcagccgtgt gtgtggccaa actgcatgac atcaatgctc agatggtgga ggaccagggc       480
     ttcctggact ctctccggga cctgatcgct gactccaatc ccatggttgt ggccaatgca       540
     gttgctgctc tgtctgagat cagcgagtct caccccaaca gcaaccttct ggacctgaac       600
     cctcagaaca tcaacaagct tctgacggct cttaatgagt gcactgaatg gggccagatc       660
     ttcatcctgg actgcctctc caactacaac cccaaagacg agcgggaggc ccagagtatc       720
     tgtgagcggg tgacgccacg tctctcgcat gctaattcag ctgtggtgct ttcggcggta       780
     aaggtactga tgaagttttt ggagctcctg cccaaagact ctgattacta caacactctt       840
     ctgaagaagc tctctcctcc cctcgtcaca ctgttatctg gcgaaccaga ggtccaatat       900
     gtggcgctca ggaatatcaa ccttattgtg cagaaacggc ctgagatttt gaagcaagag       960
     attaaagtgt tctttgtcaa gtacaatgac cctatatatg tcaagttgga gaaactggac      1020
     atcatgatcc gactagcctc tcatgccaac atcgcccagg tcctggctga gctgaaggaa      1080
     tatgccactg aggtggatgt agactttgtt cggaaagccg tgcgagccat tggtcgctgt      1140
     gccatcaaag tggagcaatc cgctgagcgc tgtgttagca ccctgctgga ccttatccag      1200
     accaaagtca actacgtcgt gcaggaagcc attgtggtca tcagggacat cttccgcaaa      1260
     tatcccaaca agtatgagag cataatcgcc actctgtgtg aaaacctgga ctctctggat      1320
     gaacctgacg ctcgaggagc catgatctgg attgttggcg aatatgcaga gcgtatcgac      1380
     aacgctgatg agctactgga gagtttcctc gagggcttcc atgatgaaag cactcaggtc      1440
     cagttgactc tgctgacagc catagtgaag ctgttcctga agaagccctc tgagactcag      1500
     gagctggttc agcaggtgct cagtctggcc actcaggact ctgataaccc tgacctgcgt      1560
     gaccgcggct acatctactg gcgtctgctg tccactgatc ctgtcaccgc taaagaggtg      1620
     gtgctgtctg agaaacctct gatctcagag gagacggacc tgattgagcc caccctgctg      1680
     gacgagctca tctgccacat tggctcgctg gcctcagtct accacaagcc cccaaatgcc      1740
     tttgtggagg gaagccatgg cattcatcgc aaacatctgc ccatccagca cggcagtatc      1800
     gacaccgggg agagtcccgt cagtaccggc ccggctgctt ccattgatca accccaggtc      1860
     atcccatctc agggtgacct tctgggagac ctgcttaatc tggacctcgg gccaccggtc      1920
     aatgtgcccc aggtgtcctc catgcagata gcggctgtgg atctcctggg aggtggtctt      1980
     gacagtttgc tcgggggaga tctgggagga ggtgttgggg gcagtcctgc agtgggccag      2040
     aacttcatcc catcatcggt gcccaacacc tttgcaccat ctccgacacc tgccgctctt      2100
     agcagcggac tcaatgacct gtttgagttg tccacaggaa tggccactgc tacaggagga      2160
     tatgtggctg ctaaaactgt gtggctgcca gcagtcaagg ccaaaggact ggagatttct      2220
     ggaaccttct ctcggcgtca agggcacatg tatatggaca tgaccttcac caataaagca      2280
     ttgcagcata tgactgactt tgccatccag ttcaacaaga acagttttgg tgtaatcccc      2340
     accacacctc tccccgtcca cactccactg atgcccagtc agagcatcga catctccctc      2400
     ccgctcaaca ccatcggccc tgtgatgaaa atggatccac tcaacaacct acaggtggcc      2460
     gtgaaaaaca atattgatgt cttctacttt agcacgctga tccctctcaa tgtcttcttc      2520
     gtggaggatg gcaaaatgga gcgtcaggtg ttcttggcca catggaagga cattcctaat      2580
     gagaatgagc tgcaatacca gatcaaagac tgccacttaa acgcagatac ggtgtcgggc      2640
     aaactgcaga gcaacaatgt ctacaccatc gcaaagagga acgtggaagg ccaggacatg      2700
     ttgtaccagt cgctcaaact caccaacggg atctggattc tcgccgagct ccgcatacaa      2760
     cccggcaatc ccaattacac gctgtctctg aagtgcaggg ctccagaggt ttctcagtac      2820
     gtgtaccaga tgtacgatgc cactctgaag aactga                                2856
//

If you have problems or comments...

PBIL Back to PBIL home page