(data stored in ACNUC16935 zone)

EMBL: BC103477.UBC

BC103477.UBC         Location/Qualifiers
FT   CDS_pept        59..1351
FT                   /codon_start=1
FT                   /gene="Ubc"
FT                   /product="Ubc protein"
FT                   /db_xref="GOA:Q63429"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:5L9U"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63429"
FT                   /protein_id="AAI03478.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI
FT                   PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEP
FT                   SVNTKKVKQEDTRTFLTTVSRKSPSCACSWV"
     atgcagatct ttgtgaaaac cttaactggt aagaccatca ccctggaggt cgagcccagt        60
     gacaccattg aaaatgtcaa ggcaaagatc caggacaagg agggcatccc ccctgaccag       120
     cagaggctga tctttgcagg caagcagctg gaagatggcc gcaccctgtc agactacaac       180
     atccagaagg agtccacctt gcacctggtc cttcgcctca gagggggcat gcagatcttt       240
     gtgaagaccc tgacaggcaa gaccatcacc ctggaggtcg agcccagtga caccattgaa       300
     aatgtcaagg caaagatcca ggacaaggag ggcatccccc ctgaccagca gaggctgatc       360
     tttgcaggca agcagctgga agatggccgc accctgtcag actacaacat ccagaaggag       420
     tccaccctgc acctggtcct tcgcctcaga gggggcatgc agatctttgt gaagaccctg       480
     acaggcaaga ccatcaccct ggaggtcgag cccagtgaca ccattgaaaa tgtcaaggca       540
     aagatccagg acaaggaggg catcccccct gaccagcaga ggctgatctt tgcaggcaag       600
     cagctggaag atggccgcac cctgtcagac tacaacatcc agaaggagtc caccctgcac       660
     ctggtccttc gcctcagagg gggcatgcag atctttgtga agaccctgac aggcaagacc       720
     atcaccctgg aggtcgagcc cagtgacacc attgaaaatg tcaaggcaaa gatccaggac       780
     aaggagggca tcccccctga ccagcagagg ctgatctttg caggcaagca gctggaagat       840
     ggccgcaccc tgtcagacta caacatccag aaggagtcca ccctgcacct ggtccttcgc       900
     ctcagagggg gcatgcagat ctttgtgaag accctgacag gcaagaccat caccctggag       960
     gtcgagccca gtgacaccat tgaaaatgtc aaggcaaaga tccaggacaa ggagggcatc      1020
     ccccctgacc agcagaggct gatctttgca ggcaagcagc tggaagatgg ccgcaccctg      1080
     tcagactaca acatccagaa ggagtccacc ctgcacctgg tccttcgcct cagagggggc      1140
     atgcagatct ttgtgaagac cctgacaggc aagaccatca ctctggatgt cgagcccagt      1200
     gttaacacca agaaggtcaa acaggaagat actcgtacct ttctcaccac agtatctaga      1260
     aagagccctt cttgtgcttg ttcttgggtt tga                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page