(data stored in ACNUC26462 zone)

EMBL: BC106754.CAMK1

BC106754.CAMK1       Location/Qualifiers
FT   CDS_pept        147..1259
FT                   /codon_start=1
FT                   /gene="CAMK1"
FT                   /product="calcium/calmodulin-dependent protein kinase I"
FT                   /db_xref="GOA:Q14012"
FT                   /db_xref="H-InvDB:HIT000338497.9"
FT                   /db_xref="HGNC:HGNC:1459"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:4FG7"
FT                   /db_xref="PDB:4FG8"
FT                   /db_xref="PDB:4FG9"
FT                   /db_xref="PDB:4FGB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14012"
FT                   /protein_id="AAI06755.1"
FT                   /translation="MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKL
FT                   VAIKCIAKEALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELF
FT                   DRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDF
FT                   GLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDEN
FT                   DAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTA
FT                   LDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTP
FT                   VAGGPAAGCCCRDCCVEPGTELSPTLPHQL"
     atgctggggg cagtggaagg ccccaggtgg aagcaggcgg aggacattag agacatctac        60
     gacttccgag atgttctggg cacgggggcc ttctcggagg tgatcctggc agaagataag       120
     aggacgcaga agctggtggc catcaaatgc attgccaagg aggccctgga gggcaaggaa       180
     ggcagcatgg agaatgagat tgctgtcctg cacaagatca agcaccccaa cattgtagcc       240
     ctggatgaca tctatgagag tgggggccac ctctacctca tcatgcagct ggtgtcgggt       300
     ggggagctct ttgaccgtat tgtggaaaaa ggcttctaca cggagcggga cgccagccgc       360
     ctcatcttcc aggtgctgga tgctgtgaaa tacctgcatg acctgggcat tgtacaccgg       420
     gatctcaagc cagagaatct gctgtactac agcctggatg aagactccaa aatcatgatc       480
     tccgactttg gcctctccaa gatggaggac ccgggcagtg tgctctccac cgcctgtgga       540
     actccgggat acgtggcccc tgaagtcctg gcccagaagc cctacagcaa ggctgtggat       600
     tgctggtcca taggtgtcat cgcctacatc ttgctctgcg gttaccctcc cttctatgac       660
     gagaatgatg ccaaactctt tgaacagatt ttgaaggccg agtacgagtt tgactctcct       720
     tactgggacg acatctctga ctctgccaaa gatttcatcc ggcacttgat ggagaaggac       780
     ccagagaaaa gattcacctg tgagcaggcc ttgcagcacc catggattgc aggagataca       840
     gctctagata agaatatcca ccagtcggtg agtgagcaga tcaagaagaa ctttgccaag       900
     agcaagtgga agcaagcctt caatgccacg gctgtggtgc ggcacatgag gaaactgcag       960
     ctgggcacca gccaggaggg gcaggggcag acggcgagcc atggggagct gctgacacca      1020
     gtggctgggg ggccggcagc tggctgttgc tgtcgagact gctgcgtgga gccgggcaca      1080
     gaactgtccc ccacactgcc ccaccagctc tag                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page