(data stored in ACNUC15260 zone)

EMBL: BC119334.OLFR61

BC119334.OLFR61      Location/Qualifiers
FT   CDS_pept        97..1032
FT                   /codon_start=1
FT                   /gene="Olfr61"
FT                   /product="olfactory receptor 61"
FT                   /db_xref="GOA:Q8VGM2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333885"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGM2"
FT                   /protein_id="AAI19335.1"
FT                   /translation="MMFSPNQTEVTEFILEGFSEHATLRLLLTGCFLSLYTIALMGNIV
FT                   IIALVTSSTGLHSPMYFFLCNLATMDIVCTSSVIPKALIGLVSEENTISFKGCMAQLFF
FT                   LLWSLSSELLLLTVMAYDRYVAICFPLHYSSRMSPQLCGALAVGVWSICAVNASVHTGL
FT                   MTRLSFCGPKVITHFFCEIPPLLLLSCSPTYINSVMTLVADAFYGCINFVLTLLSYGCI
FT                   IASVLRMRSAEGKRKAFSTCSSHLIVVSVYYSSVFCAYVSPASSYSPERSKVTSVLYSI
FT                   LSPTLNPLIYTLRNKDVKLALGRLLPFFPK"
     atgatgttca gtcccaacca gacagaagtg acagagttta tactagaagg gttttcagaa        60
     catgctactc taagacttct cctgacaggc tgcttcctgt ccctctacac aatcgctcta       120
     atgggcaaca ttgttatcat tgctttggtc acctccagca ctgggctcca cagtcccatg       180
     tactttttcc tgtgcaacct ggccaccatg gacattgtgt gcacctcctc tgtgattcct       240
     aaggccctga ttggcctagt gtctgaagaa aacaccatct ccttcaaagg atgcatggct       300
     cagctcttct ttcttctgtg gtccttgtct tcggagctgc tgctgctcac ggtcatggcc       360
     tatgaccgct atgtggccat ctgctttccc ctgcactaca gctctagaat gagcccacag       420
     ctctgtgggg ccctggccgt gggtgtatgg tccatctgtg ctgtgaatgc atctgtgcac       480
     actggcctga tgacacggct gtcattctgt ggccccaagg tcatcaccca cttcttctgt       540
     gagattcccc cactcctcct gctttcctgt agtcccacat acattaatag cgttatgaca       600
     cttgtggcag atgcctttta tgggtgcatc aactttgtgc taaccttgtt atcctatggc       660
     tgcatcattg ccagtgttct gcgcatgcgt tctgctgagg gcaagaggaa ggccttttct       720
     acctgttcat cccacctcat cgtggtctca gtgtactact catctgtgtt ctgtgcctat       780
     gtcagtcctg cctccagcta cagcccagaa agaagcaaag ttacctccgt gctgtactcg       840
     atcctcagcc caaccctgaa ccccctcatc tatacactaa ggaacaagga tgtcaaactc       900
     gccctgggaa gactcttgcc ctttttcccc aagtag                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page