(data stored in ACNUC10409 zone)

EMBL: BC120986.TM6SF2

BC120986.TM6SF2      Location/Qualifiers
FT   CDS_pept        25..>1010
FT                   /codon_start=1
FT                   /gene="TM6SF2"
FT                   /product="TM6SF2 protein"
FT                   /db_xref="GOA:Q9BZW4"
FT                   /db_xref="H-InvDB:HIT000388183.7"
FT                   /db_xref="HGNC:HGNC:11861"
FT                   /db_xref="InterPro:IPR033118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9BZW4"
FT                   /protein_id="AAI20987.1"
FT                   /translation="MDIPPLAGKIAALSLSALPVSYALNHVSALSHPLWVALMSALILG
FT                   LLFVAVYSLSHGEVSYDPLYAVFAVFAFTSVVDLIIALQEDSYVVGFMEFYTKEGEPYL
FT                   RTAHGVFICYWDGTVHYLLYLAMAGAICRRKRYRNFGLYWLGSFAMSILVFLTGNILGK
FT                   YSSEIRPAFFLTIPYLLVPCWAGMKVFSQPRALTRCTANMVQEEQRKGLLQRPADLALV
FT                   IYLILAGFFTLFRGLVVLDCPTDACFVYIYQYEPYLRDPVAYPKVQMLMYMFYVLPFCG
FT                   LAAYALTFPGCSWLPDWALVFAGGIGQAQFSHMGASMHLRTPFTYRVP"
     atggacatcc cgccgctggc cggcaagatc gcggcgctgt cgctgagcgc cctcccggtg        60
     tcctacgcgc tcaaccacgt ctcggcgctc tcgcaccccc tgtgggtggc attgatgagc       120
     gccctaatcc tgggtctgct tttcgtggcg gtctacagct tgtcccatgg cgaggtctcc       180
     tatgacccac tctatgctgt cttcgctgtc ttcgccttca cctcggttgt ggacctcatc       240
     atcgctcttc aggaagacag ctatgtggtg ggcttcatgg agttctacac caaggaggga       300
     gagccatacc tgcgcacagc gcacggagtc ttcatctgct actgggatgg cactgttcac       360
     tacctcctct acctggccat ggccggagcc atctgcagaa ggaagagata ccggaatttt       420
     ggactctact ggctgggttc cttcgccatg agcatcctgg tgttccttac aggaaacatt       480
     cttggcaaat acagctccga gatcaggcct gccttcttcc tcaccatccc ctacctgctg       540
     gtgccatgct gggctggcat gaaggtcttc agccagcccc gggcgctaac ccgctgcacc       600
     gccaacatgg tgcaagagga acaaagaaag ggactcctgc agcgtccggc tgacctggcc       660
     cttgtcatat atctcatcct tgctggcttc ttcactctgt tccggggcct ggtggtgctt       720
     gattgcccca cagatgcctg ctttgtctat atctaccagt atgagccata cctgcgggac       780
     cctgtggcct accctaaggt gcagatgctg atgtacatgt tttatgtcct gcctttctgc       840
     ggcctggctg cctatgctct caccttccct ggttgctcct ggcttccaga ctgggccttg       900
     gtgtttgctg gaggcatcgg ccaggcacag ttctcgcaca tgggggcttc catgcacctg       960
     cgcacaccct tcacctaccg tgtgcc                                            986
//

If you have problems or comments...

PBIL Back to PBIL home page