(data stored in ACNUC12215 zone)

EMBL: BC137522.XKR3

BC137522.XKR3        Location/Qualifiers
FT   CDS_pept        71..1450
FT                   /codon_start=1
FT                   /gene="XKR3"
FT                   /product="XK, Kell blood group complex subunit-related
FT                   family, member 3"
FT                   /db_xref="GOA:Q5GH77"
FT                   /db_xref="H-InvDB:HIT000501412.4"
FT                   /db_xref="HGNC:HGNC:28778"
FT                   /db_xref="InterPro:IPR018629"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5GH77"
FT                   /protein_id="AAI37523.1"
FT                   /translation="METVFEEMDEESTGGVSSSKEEIVLGQRLHLSFPFSIIFSTVLYC
FT                   GEVAFGLYMFEIYRKANDTFWMSFTISFIIVGAILDQIILMFFNKDLRRNKAALLFWHI
FT                   LLLGPIVRCLHTIRNYHKWLKNLKQEKEETQVSITKRNTMLEREIAFSIRDNFMQQKAF
FT                   KYMSVIQAFLGSVPQLILQMYISLTIREWPLNRALLMTFSLLSVTYGAIRCNILAIQIS
FT                   NDDTTIKLPPIEFFCVVMWRFLEVISRVVTLAFFIASLKLKSLPVLLIIYFVSLLAPWL
FT                   EFWKSGAHLPGNKENNSNMVGTVLMLFLITLLYAAINFSCWSAVKLQLSDDKIIDGRQR
FT                   WGHRILHYSFQFLENVIMILVFRFFGGKTLLNCCDSLIAVQLIISYLLATGFMLLFYQY
FT                   LYPWQSGKVLPGRTENQPEAPYYYVNIEKTEKNKNKQLRNYCHSCNRVGYFSIRKSMTC
FT                   S"
     atggagacag tgtttgaaga gatggatgaa gaaagcacag gaggagtttc atcttcgaaa        60
     gaagaaatag tccttggcca gagactccat ctaagctttc cttttagcat tatcttctca       120
     actgttctct actgtggtga ggttgccttt ggtttataca tgtttgaaat ttatcgaaaa       180
     gctaatgaca cattctggat gtcatttacc atcagcttta ttattgtggg ggcaattttg       240
     gatcaaatta tcctgatgtt tttcaacaaa gacttgagga gaaataaggc tgcattactt       300
     ttttggcaca ttcttctttt aggacctatt gtgaggtgtt tgcacaccat tagaaattac       360
     cacaaatggt tgaaaaatct taaacaggag aaggaagaga ctcaagttag catcacaaag       420
     agaaacacga tgctggaaag ggagattgca ttctcaatcc gggataattt catgcagcag       480
     aaggctttca agtacatgtc agtgattcag gcttttctcg gttctgttcc acaattaatt       540
     ttgcagatgt atatcagtct cactatacga gaatggcctt tgaatagagc attgctgatg       600
     acattttccc tgttatcagt tacttatggg gccattcgct gcaatatact ggccatccag       660
     atcagcaatg atgatactac cattaagcta ccgccgatag aattcttctg tgtcgtgatg       720
     tggcgttttt tggaggttat ctcacgtgta gtgactctgg catttttcat tgcatctctg       780
     aaactgaaga gcctacccgt tttgttaatc atatattttg tatcattgtt ggcaccgtgg       840
     ctggagtttt ggaaaagtgg agctcatctt cctggcaaca aagaaaataa ttccaatatg       900
     gtgggtacag tactgatgct tttcttgatc acactgctat atgctgccat caacttctcc       960
     tgctggtcag cagtgaaact gcagttgtca gatgacaaaa taattgacgg gagacagagg      1020
     tggggccata gaatcctaca ctacagcttt cagtttttag aaaatgtgat aatgatattg      1080
     gtatttaggt tctttggagg gaaaactttg ctgaattgtt gtgactcatt aattgccgtg      1140
     cagctcatca taagctacct attggccact ggctttatgc tcctcttcta tcagtatttg      1200
     tacccatggc agtcaggcaa agtgttgcca ggacgtactg aaaatcagcc agaagcaccg      1260
     tactattatg taaacatcga gaaaactgaa aagaataaaa ataagcagct gaggaattac      1320
     tgtcactcct gcaatagggt tggatatttt tcaatcagaa aaagtatgac atgttcataa      1380
//

If you have problems or comments...

PBIL Back to PBIL home page