(data stored in ACNUC30567 zone)

EMBL: BC140615.ADAM3A

BC140615.ADAM3A      Location/Qualifiers
FT   CDS_pept        38..2251
FT                   /codon_start=1
FT                   /gene="ADAM3A"
FT                   /product="ADAM3A protein"
FT                   /db_xref="GOA:A5D7M5"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034027"
FT                   /db_xref="InterPro:IPR036436"
FT                   /db_xref="UniProtKB/TrEMBL:A5D7M5"
FT                   /protein_id="AAI40616.1"
FT                   /translation="MLSLLLLLTGLGQLASAGHHSETARLQITVPRKIETNTKDGSISE
FT                   THVAYSIQIDKKTYTLPLEKQSFLDSNLLVYSYNKSRVLYPDSSFIKGHCFYQGYATEI
FT                   PNSVVTLSTCSGLRGLLQFENVSYGIEPLESSTTYEHVIYPFRDKKSDFSPISADQSYK
FT                   ILVKSNKDSGVLLKRVLKIHVIIDKALYHYMGSEVALASEKIIYVFSLINTMYSQLQVS
FT                   VILTSLEIWSDLNKISTDGDAHDVLQRFVSWREKSLLQSSHDLAYLLIYRDHPNYVGAT
FT                   YHGMACDPKFAAGLALYSKMITLEAFSVIFTQLLGIMLGLKYNNNIYECSCPGIACIMN
FT                   PEAIRSHGIKFFSSCSIDEFKHTTSQPKFECLQNRTVPKVVPQGRQSICGNGVLEPPEQ
FT                   CDCGSIENCEHTKCCNPLNCVLIGNADCGSGPCCGKKTCMILDRGTECRRSTDPCDFPE
FT                   ICNGISEFCVPDMRAADLQTCNNKSSYCFRGICQDRTKQCVTLFGKYAKESSYQCTEEV
FT                   NYQDDDFGNCLGRTCFFHQHLCGKLVCHWTHSAIVSRNDIDVQYTYLGGHICMSANLRT
FT                   RRYPDPTVAANGSMCDENKFCDNGACRAIHQYTQYQDCDPLTKCKGHGICNTRLHCHCD
FT                   VGYVPPDCEEIALSPGGSIDDGFWNLEIDESKTAYLIKRRRASQKNNLMISFYVLLPFF
FT                   ILTAIIALKWNKMKIFWNKEGTISGGSPSEISNSNSSQSNSND"
     atgttatctc tcctgctact cctcacaggg ctgggccagc tggcctccgc gggccatcac        60
     tctgaaacag cacgtctaca aattacagtg ccacggaaga ttgagacaaa caccaaagat       120
     ggcagtattt cagaaacaca tgtcgcctat tccatccaaa ttgacaagaa aacctacact       180
     ctcccacttg aaaaacagtc atttttagac tctaacctcc tggtgtattc atacaacaaa       240
     tcgagggtgt tatatccaga ttcttcattt ataaagggcc attgctttta tcaaggatat       300
     gccacagaga ttccaaattc agttgtgaca cttagtacct gctctggact caggggatta       360
     ttgcagtttg agaatgtcag ttatggaatt gaaccactgg aatcttcaac tacatatgag       420
     catgttattt atccgttcag agataaaaaa agtgattttt ctcccatatc tgcagatcaa       480
     tcctacaaaa ttcttgtgaa atcaaataaa gattcaggtg tgctgttgaa aagagttctg       540
     aaaatacatg tcattattga taaagctttg tatcattata tgggttctga agtggcactt       600
     gcatctgaga aaattatcta tgtttttagt ctaatcaaca ctatgtattc tcagcttcaa       660
     gtgtctgtta tattaacttc tctggaaatc tggtcagatc taaataagat ttcaactgat       720
     ggggatgcac atgatgtact acaaagattt gtgtcctgga gagaaaagtc tttattacaa       780
     agctcccatg atttggcata cttattaatt tacagggacc atcctaatta tgtaggagca       840
     acatatcatg gaatggcatg tgatccaaag tttgctgcag gacttgctct gtattcgaag       900
     atgataactt tagaggcatt ttcagttatt ttcacgcagt tacttggaat tatgctggga       960
     ttaaagtata ataataacat ctatgaatgt tcctgtccag gaattgcatg cataatgaat      1020
     cctgaagcaa tacgttccca tggcataaag ttttttagca gttgcagcat agatgaattt      1080
     aaacatacaa cttcacagcc taaatttgaa tgtcttcaga atcgaacagt tccaaaagtg      1140
     gttccccaag gaagacaatc catttgcggc aatggagttc tggagccacc tgaacaatgt      1200
     gactgtggtt ccatcgagaa ttgtgagcat actaaatgct gtaatccttt aaactgtgta      1260
     ctgattggaa atgcagactg tggttctgga ccatgttgtg gaaaaaaaac ttgtatgata      1320
     cttgatagag gaacagagtg taggagaagc actgatccat gtgattttcc agaaatttgc      1380
     aatgggatat ctgaattttg tgtacctgat atgagagctg ccgacttaca aacgtgcaat      1440
     aataaatctt cctattgctt tagaggaata tgccaagata gaacaaagca gtgcgtcaca      1500
     ttgtttggaa aatatgctaa agaatctagt tatcagtgta cagaagaagt gaattatcaa      1560
     gacgatgatt ttggaaactg tctaggaaga acttgttttt ttcaccaaca tctttgtgga      1620
     aagttagttt gccactggac acattcagct atagtatcaa ggaatgacat tgatgttcaa      1680
     tatacctacc ttggaggaca catatgtatg tcagcaaatc taagaacccg tagatatcca      1740
     gaccctactg ttgcagctaa tggaagcatg tgtgatgaaa ataagttttg tgacaatgga      1800
     gcttgcaggg caatccatca atatacacag tatcaggatt gtgacccact taccaaatgc      1860
     aaaggacatg ggatttgcaa tactcgctta cattgtcact gtgatgttgg atatgtgccc      1920
     ccagattgtg aggaaatagc cttatcacca ggaggaagta tcgatgatgg attttggaat      1980
     ttagaaattg atgaatctaa aactgcatac ttgataaaac gacgtcgtgc ctctcaaaaa      2040
     aataacctga tgatcagttt ctacgtactc ttacctttct tcattttaac tgctatcatt      2100
     gctcttaaat ggaataaaat gaagatattt tggaacaaag agggaacaat aagtggggga      2160
     tctccatcag aaatcagcaa tagtaacagc agtcagtcta acagcaatga ctaa            2214
//

If you have problems or comments...

PBIL Back to PBIL home page