(data stored in ACNUC27125 zone)

EMBL: BC141079.PPP3CC

BC141079.PPP3CC      Location/Qualifiers
FT   CDS_pept        64..1605
FT                   /codon_start=1
FT                   /gene="Ppp3cc"
FT                   /product="protein phosphatase 3, catalytic subunit, gamma
FT                   isoform"
FT                   /db_xref="GOA:P48455"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="MGI:MGI:107162"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48455"
FT                   /protein_id="AAI41080.1"
FT                   /translation="MSVRRPQFSTTERVIKAVPFPPTRRLTLKEVFENGKPKMDLLKNH
FT                   LVKEGRVEEEVALKIINDGAAILKQEKTMIEVEAPITVCGDVHGQFFDLMKLFEVGGSP
FT                   SNTRYLFLGDYVDRGYFSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECR
FT                   IKYSEMVYDACMHTFDCLPLAALLNQQFLCVHGGMSPEITCLEDIRKLDRFSEPPAFGP
FT                   VCDLLWSDPLEDYGSEKTLEHYTHNTVRGCSYFFSYPAVCEFLQNNSLLSIIRAHEAQD
FT                   AGYRMYRKNQATGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLP
FT                   NFMDVFTWSLPFVGEKVTEMLVNILNICSDEEMNVTDEEGATTGRKEVIKNKIRAIGKM
FT                   ARVFTVLREESENVLTLKGLTPTGTLPLGVLSGGKQTIETAKQEAAEEREAIRGFTIAH
FT                   RIRSFEEARGLDRINERMPPRKEASYHHDAGRMHSHSHPPHPQASRRTDHGKKAL"
     atgtccgtga ggcgccctca gttctccacg accgagcgcg tcatcaaagc tgtccccttt        60
     cctccaaccc gacggctaac tttgaaggaa gtttttgaga atgggaaacc taaaatggat       120
     cttttgaaaa accatttagt aaaagaaggt cgggtggaag aggaggtggc cttaaagatc       180
     atcaatgatg gggctgccat cctgaagcag gagaagacca tgatagaggt ggaggctccg       240
     atcacagtgt gtggtgatgt tcatggacaa ttctttgacc tgatgaagtt gtttgaagtt       300
     gggggatcac ctagtaatac tcgctacctc ttcctgggtg actatgtgga cagaggctat       360
     ttcagtatag agtgtgtgct gtatctatgg agcttaaaga ttaaccatcc taaaacattg       420
     tttctgcttc gaggaaatca tgaatgcagg catcttacag agtacttcac cttcaaacag       480
     gaatgtcgga tcaagtattc agagatggtg tacgatgcgt gcatgcacac tttcgactgt       540
     cttcctcttg ctgccctctt aaaccagcag tttctctgtg tacatggagg aatgtctcct       600
     gaaattactt gtttagagga cattaggaaa ttagataggt tttctgagcc tcctgctttt       660
     gggccagtgt gtgacctgct gtggtctgat cccttagagg actacggcag cgagaagacc       720
     ctggagcact atacccacaa cactgtccga ggctgctcct acttcttcag ttaccctgca       780
     gtttgtgaat ttttacagaa caacagttta ttatcaataa tcagagccca tgaagcccag       840
     gatgcggggt accgaatgta taggaagaac caagcaactg gctttccgtc acttattacg       900
     attttctctg cccctaatta cctagatgtc tataacaata aagctgcagt gttgaagtat       960
     gaaaacaatg tcatgaacat caggcagttc aactgttccc cacaccccta ctggctccca      1020
     aacttcatgg atgttttcac gtggtctttg ccttttgttg gagagaaagt gacagagatg      1080
     ctggtcaata ttctcaacat atgctcggat gaagaaatga acgtaaccga tgaagaagga      1140
     gctactacag gtcgaaaaga agtcatcaag aataaaatcc gagccattgg gaaaatggcc      1200
     cgggtcttta cggttcttcg ggaagagagt gagaatgtgc tgaccctcaa gggcctcact      1260
     cccacaggca cactcccact gggggtcctc tctggaggaa agcagaccat tgagactgcc      1320
     aaacaagaag ccgcagagga gcgggaagcc atcagaggtt ttacaattgc acacaggatc      1380
     cgaagttttg aagaagcccg aggtctagac cgaattaatg agagaatgcc accccgaaaa      1440
     gaggcttcat atcatcatga tgcagggagg atgcactcac actcgcatcc gccacaccca      1500
     caggcgtcaa gaaggaccga ccatggaaag aaagccctgt aa                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page