(data stored in ACNUC4305 zone)

EMBL: BC146052.MGC152639

BC146052.MGC152639   Location/Qualifiers
FT   CDS_pept        111..1661
FT                   /codon_start=1
FT                   /gene="MGC152639"
FT                   /product="MGC152639 protein"
FT                   /db_xref="InterPro:IPR029357"
FT                   /db_xref="UniProtKB/TrEMBL:A6H6Z2"
FT                   /protein_id="AAI46053.1"
FT                   /translation="MDASRRVTATSVLPTFDASCLFKGHLSTKSNALCTDSSSLRLSTL
FT                   QLVKNHMAVHYNKILSAKAAVDCSVPLSMSASIKYADQQRREKLKKELARCGRGLKFTK
FT                   TTVHPKSHSRSLLNALQKPSGEPQDENSLLIEEVNEFPSFTQSPVISSERLSLPKSQNV
FT                   LTNCTEKNSSCSMSSMDYTASGSKKPSSGTSYGRGPRGTFPGSQKFQLVISKAPSGDLL
FT                   DKHSEHFSNRHLPFTPRTLKTEAKSFLSQYRYYTPAKRKKNFTNRRIEAETQTELSSFK
FT                   SDFETVEIKNATDSEMNVTQASGCVSYGTKGRTTPSASPGRELPWGKVRDSALQCSSPR
FT                   AVCQYSLQPPSGRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKH
FT                   HLEEEKMRQLLHVLKVDLGCMSKENSGKLDSVDTLHLCDVEKAENLEQNENKSEQDLII
FT                   QQERQEYQKALNMLLTIPKEENEIVSSNEFFLPIHKSKYSEEVIIQQYLKRQGLSSNQ"
     atggacgcca gccggagagt cacagcaacc tctgtccttc ccacatttga tgcatcatgc        60
     ctatttaaag gacacttgag caccaaaagt aatgctttgt gcactgactc ctcctctctc       120
     agactaagta ccctccaact ggtcaagaat cacatggctg ttcactataa taaaatcctt       180
     tcagccaaag ctgcagtaga ctgctcagtt ccactaagca tgagtgccag catcaaatat       240
     gcagaccaac agcgaagaga gaaactcaaa aaggaattag caaggtgtgg gagggggctg       300
     aaatttacta agactacagt gcatcctaaa agtcattcca ggtcattact taacgctcta       360
     caaaagcctt caggagaacc acaggatgaa aacagtttat taatcgaaga agtgaatgaa       420
     tttccatctt ttacacagtc accagtaatt tcttctgaga gactaagtct acctaagtct       480
     cagaacgtcc tcacgaattg tactgagaag aactccagct gctccatgtc cagcatggat       540
     tacactgcct ctgggtccaa gaaaccatcc tctggaacct cctacggcag agggcccagg       600
     ggcacattcc ccggttccca gaagtttcag ttagttattt caaaagcacc cagtggggac       660
     cttttggaca aacattctga acacttttct aacagacatt tgccattcac cccacgcact       720
     ttaaaaacag aagccaaatc tttcctgtca cagtatcgat attatacacc tgccaaaaga       780
     aaaaagaatt ttacaaatcg gcggatagaa gctgaaactc agactgaatt aagcagcttt       840
     aaatctgatt ttgagacagt tgagatcaag aacgccacag attcagaaat gaacgtaacg       900
     caggcatctg gttgtgtgtc atatggtacc aaaggaagaa caaccccttc agcttcacca       960
     gggcgtgagt taccgtgggg caaggttaga gacagtgccc tccagtgctc ctcgccaagg      1020
     gcagtatgtc aatattcact gcagcctcct tcagggagaa aaatatattc tgatgaagaa      1080
     gaactgttgt atctgagttt cattgaagat gtaacagatg aaattttgaa actaggttta      1140
     ttttcaaaca ggtttctgga acgactgttt gagagacata taaaacaaaa taaacatcat      1200
     ttggaggagg aaaaaatgcg ccagctgcta catgtcttaa aggtggactt aggctgcatg      1260
     tccaaggaaa actcaggaaa gctagacagc gtggatacat tgcatttatg tgatgttgaa      1320
     aaggctgaga atttagaaca aaatgaaaat aaaagtgaac aagatttaat cattcaacag      1380
     gaacgtcagg aataccaaaa agctttgaat atgttattga ctataccaaa ggaagagaat      1440
     gagatagtct cttcaaatga atttttcctc cccatccata aatcaaagta ttcagaagag      1500
     gttatcattc aacagtatct aaagcgtcaa ggcctttcta gtaatcagtg a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page