(data stored in ACNUC10243 zone)

EMBL: BC158074.EG627828

BC158074.EG627828    Location/Qualifiers
FT   CDS_pept        29..1084
FT                   /codon_start=1
FT                   /gene="EG627828"
FT                   /product="EG627828 protein"
FT                   /db_xref="GOA:B2RXM2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034513"
FT                   /db_xref="InterPro:IPR034516"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:3643578"
FT                   /db_xref="UniProtKB/TrEMBL:B2RXM2"
FT                   /protein_id="AAI58075.1"
FT                   /translation="MEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVM
FT                   RDPQTKRSRGFGFVTYSCVEEVDAAMCARPYKVDGRVVEPKRAVSREDSVKPGAHLTVK
FT                   KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVV
FT                   QKYHTINGHNCEVKKALSKQEMRSAGSQRDRGGGSGNFMGRGGNFGGGGGNFGGRGGYG
FT                   GGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGYGGGGGG
FT                   YDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPYGGGYGSG
FT                   GGSGGYGSRRF"
     atggagggcc atgatccaaa ggaaccagag cagctgagga agctatttat tggtggtctg        60
     agctttgaaa ccacagatga tagcttaaga gaacattttg agaaatgggg cacacttaca       120
     gactgtgtgg taatgagaga tccccaaaca aaacgttcca gaggctttgg ttttgtgacc       180
     tactcttgtg ttgaagaggt ggatgctgca atgtgtgctc ggccatacaa ggttgatggg       240
     cgtgtggtgg aaccaaagag agctgtctct agagaggatt ctgtaaagcc tggtgcccat       300
     ttaacggtga agaaaatttt tgttggtggt attaaagagg atacggaaga atataacctg       360
     agagactact ttgaaaagta tggcaagatt gaaaccatag aggttatgga agacaggcag       420
     agtgggaaaa agagaggatt tgcttttgta acttttgatg atcatgacac agttgataaa       480
     attgttgttc agaaatacca cactattaat gggcataatt gtgaagtgaa aaaggccctt       540
     tctaaacaag agatgcggtc tgctggatca cagagagatc gtggaggtgg atctggcaac       600
     tttatgggtc gtggaggaaa ctttggaggt ggtggaggaa actttggagg aagaggtggc       660
     tatggtggtg gaggtggtgg cagcagaggt agttatggag gtggtgatgg tggatataat       720
     ggatttggag gtgatggtgg caactatggt ggtggtcctg gttacagtag tagaggaggt       780
     tatggaggtg gtggaccagg atatggaaac cagggtggtg gatatggtgg tggaggagga       840
     ggctatgatg gttacaatga aggaggaaat tttggtggag gtaactatgg tggtggtgga       900
     aactataatg actttggaaa ttatagtgga cagcaacaat caaattatgg acccatgaag       960
     gggggcagtt ttggtggaag aagctcaggc agtccctatg gtggtggcta tggatctgga      1020
     ggtggaagtg gtggatatgg tagcagaagg ttttaa                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page