(data stored in ACNUC4305 zone)

EMBL: BC167139.TM4SF1

BC167139.TM4SF1      Location/Qualifiers
FT   CDS_pept        <1..572
FT                   /codon_start=3
FT                   /gene="tm4sf1"
FT                   /product="tm4sf1 protein"
FT                   /db_xref="GOA:B2RZF7"
FT                   /db_xref="InterPro:IPR008661"
FT                   /db_xref="UniProtKB/TrEMBL:B2RZF7"
FT                   /protein_id="AAI67139.1"
FT                   /translation="LILAIFCIAANILLFFPNGETQYASQNHLSRFVWFFHGIGGAGLL
FT                   MLLPAGVFIGLENEDCCGCCGNERCGKSCAMLSSILAALIGVAGAGYCVVISALGLAEG
FT                   PLCLNNNQWSYAFESTNGKYLTDYQSWSTCTEPRNVVVWNVTLFSILLGLSGIQVILCL
FT                   IQIINGLIGGICGVWCCQDSQQSYAC"
     ttctcattct ggcaatattc tgcattgctg caaacatttt actttttttt cccaatggag        60
     agacccagta tgcttcacag aaccacttga gtagatttgt atggttcttc catggaattg       120
     gtggtgcagg gctactgatg ctgcttccag caggagtatt cattgggctg gaaaatgagg       180
     attgctgtgg atgctgcggc aatgagagat gtgggaaaag ctgtgcaatg ctgtcctcta       240
     ttttggctgc attaattggg gttgctggag ctggatactg tgttgttatt tctgcactgg       300
     gcttagctga ggggccactg tgtttgaaca ataaccagtg gtcttatgca ttcgaaagca       360
     ctaatgggaa atatctgaca gattatcagt cctggtccac atgcactgag ccaaggaatg       420
     ttgttgtgtg gaacgttact ctgttttcca tacttctggg tctgtctgga atccaggtca       480
     tcctgtgcct cattcagatc attaatggtt taattggtgg gatttgtggt gtgtggtgct       540
     gccaagattc acaacagtcc tacgcttgct ga                                     572
//

If you have problems or comments...

PBIL Back to PBIL home page