(data stored in ACNUC7421 zone)

EMBL: BC171148.PE1

BC171148.PE1         Location/Qualifiers
FT   CDS_pept        88..972
FT                   /codon_start=1
FT                   /gene="LOC100135206"
FT                   /product="hypothetical protein LOC100135206"
FT                   /db_xref="GOA:B7ZU88"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZU88"
FT                   /protein_id="AAI71148.1"
FT                   /translation="MGSLVRLLVGVQRALPGSVWAVRRLSSGASEVYAARLDGSNEGIA
FT                   EIIMSRPHARNSLGKVFVSEFFDTVDNLRHDSSVRVVVVKSSIPGIFCAGADLKERAQM
FT                   DNAEVSLFVQQLRKLMSEIAALPMPTIAAVDGFALGGGLELALACDLRVAASSAKMGLI
FT                   ETTRGLLPGAGGSQRLPRLLGIGLAKELIFTGRQIDGTEAQHIGLVNDAVPQNEEGDAA
FT                   YLRALELAQEILPQAPVAVRMAKLAMNRGIEVDIASGMAIEAMCYGQVIPTKDRLEGMS
FT                   AFREKRQPHYTGK"
     atggggagtc tagttaggct gcttgtgggt gtgcagcggg ctctgccggg atcagtgtgg        60
     gctgtgagaa ggctgagttc gggggcaagt gaagtatatg ctgcccggct agatggaagc       120
     aatgagggaa ttgcggagat catcatgtcc agacctcatg ccaggaattc actgggaaaa       180
     gtgtttgtca gtgagttctt tgatactgta gacaatcttc gccatgactc cagcgtccgt       240
     gtagtggttg taaaaagtag catacctggc atattctgtg ctggagccga tttaaaggag       300
     cgggcacaga tggacaatgc agaagtctcg ctctttgtgc agcagctaag aaaactgatg       360
     agtgagattg ctgcgcttcc aatgcccact attgctgcag tggatggatt tgctctgggt       420
     ggtggcctag agttggctct tgcttgtgat ctgagggtag ctgcatcttc agctaaaatg       480
     ggactaattg agaccacaag gggactactt ccaggagcag gaggatcgca gagactgcca       540
     cgcctgcttg gtatcggtct tgccaaagag cttatattta ctggtcgtca gattgatggt       600
     acagaggcac agcatatagg gctggtgaat gatgcagtgc ctcagaatga ggaaggagat       660
     gctgcatact tgagagcttt ggagctggct caggaaatac ttccccaggc tccagtggct       720
     gttaggatgg ccaagttggc tatgaatagg ggcattgagg ttgatattgc atctggaatg       780
     gccattgaag caatgtgtta tggacaggtt attcccacta aggatcgatt ggaaggaatg       840
     tcagcttttc gggagaaacg ccagccacat tacactggca aataa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page