(data stored in ACNUC7421 zone)

EMBL: BC172016.DDX3X

BC172016.DDX3X       Location/Qualifiers
FT   CDS_pept        46..2031
FT                   /codon_start=1
FT                   /gene="Ddx3x"
FT                   /product="Ddx3x protein"
FT                   /db_xref="GOA:B7ZWF1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:103064"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZWF1"
FT                   /protein_id="AAI72016.1"
FT                   /translation="MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASRRYIPPHLRNR
FT                   EATKGFYDKDSSGWSSSKDKDAYSSFGSRGDSRGKSSFFGDRGSGSRGRFDDRGRGDYD
FT                   GIGGRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYD
FT                   DIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMAC
FT                   AQTGSGKTAAFLLPILSQIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQI
FT                   YEEARKFSYRSRVRPCVVYGGAEIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFC
FT                   KYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEY
FT                   IFLAVGRVGSTSENITQKVVWVEEIDKRSFLLDLLNATGKDSLTLVFVETKKGADSLED
FT                   FLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDL
FT                   PSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAFE
FT                   HHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGGSRGFGG
FT                   GGYGGFYNSDGYGGNYNSQGVDWWGN"
     atgagtcatg tggcagtgga aaatgcgctc gggctggacc agcagtttgc tggcctagac        60
     ctgaactctt cagataatca gagtggagga agtacagcaa gcaggcgtta tatcccacct       120
     catttaagga acagagaagc tactaaagga ttctatgaca aagacagttc agggtggagt       180
     tctagtaaag ataaggatgc atacagcagt tttggatcac ggggtgattc aagagggaag       240
     tctagcttct ttggagatcg tggaagtgga tcaaggggaa ggtttgatga tcgtggacgg       300
     ggagactatg atggcattgg tggccgtgga gatagaagtg gctttggcaa atttgaaaga       360
     ggtggaaata gtcgctggtg tgacaaatca gatgaagatg actggtcaaa gccactccca       420
     ccaagtgaac gattggaaca ggaactcttt tctggaggca atactgggat taactttgag       480
     aaatatgatg acattccagt cgaagcaaca ggcaacaact gtcctccaca cattgaaagt       540
     ttcagtgatg tcgagatggg agaaattatt atgggaaaca ttgagcttac tcgttatact       600
     cgcccaactc cagtgcagaa gcatgctatt cctattatca aagagaaaag agacttgatg       660
     gcttgtgctc aaacaggctc tggaaaaact gcagcatttc tcttgcccat cttgagtcag       720
     atctatgctg atggtccagg agaagctctg agggctatga aggaaaatgg aagatatggc       780
     cgtcgtaaac agtatccaat ctctttggta ctggcaccaa cgagagaatt ggcagtgcag       840
     atctatgagg aagccagaaa attctcatac cgatctagag tccgtccttg cgtggtttat       900
     ggtggtgctg aaattggcca gcagattcga gacttagaac gtggatgcca cttgttagta       960
     gccactccag gacgtctagt ggatatgatg gagagaggga agatcgggtt agacttctgc      1020
     aaatacctgg tgttagatga agctgaccgg atgttagata tggggtttga acctcagata      1080
     cgaagaatag ttgaacaaga cactatgcct ccaaaaggtg tccgccacac tatgatgttt      1140
     agtgctactt ttcctaagga aatacagatg ctggcccgtg atttcttaga tgagtacata      1200
     tttctggctg taggaagagt tgggtctact tcagagaaca tcacacaaaa agtggtttgg      1260
     gtggaggaga tagacaaaag gtcatttctg cttgaccttc taaatgcaac aggcaaggat      1320
     tccctgactc tagtgtttgt ggagaccaaa aagggggcag attcgctgga ggatttctta      1380
     taccatgaag gatatgcttg taccagtatc catggagacc gttctcagag agatagggaa      1440
     gaggcccttc accagttccg ctcaggaaaa agcccaattc tagtggctac agcagtagca      1500
     gcaagaggac tggatatttc aaatgtgaag catgttatta attttgacct gcctagtgat      1560
     atcgaagaat atgtgcatcg cataggccgt acaggccgtg tgggaaacct tggtcttgcc      1620
     acctcattct ttaatgaaag gaatataaat atcacaaagg atttactgga tcttcttgtt      1680
     gaagcaaaac aagaagtgcc ttcttggtta gagaacatgg cttttgaaca ccactacaag      1740
     ggtagcagtc gtggacgttc taagagcagt cgatttagtg gagggtttgg tgccagagac      1800
     taccgacaga gtagcggtgc cagcagttcc agcttcagca gcagccgtgc aagcagcagt      1860
     cgaagtggtg gaggtggcca tggcggcagt cgaggatttg gtggaggtgg ctacggaggc      1920
     ttttacaaca gtgatggata tggagggaat tataactccc agggggttga ctggtggggt      1980
     aactga                                                                 1986
//

If you have problems or comments...

PBIL Back to PBIL home page