(data stored in ACNUC8465 zone)

HOGENOMDNA: BEII9_1

ID   BEII9_1; SV 1; empty ; DNA; empty ; PRO; 66727 BP.
XX
AC   NC_010578;
XX
PR   Project: 59057;
XX
DE   Beijerinckia indica subsp. indica ATCC 9039 plasmid pBIND02, complete
DE   sequence.
XX
OS   Beijerinckia indica subsp. indica ATCC 9039
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Beijerinckiaceae; Beijerinckia.
XX
RN   [1]
RP   1-66727
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., LaButti,K., Schmutz,J., Larimer,F.,
RA   Land,M., Hauser,L., Kyrpides,N., Ivanova,N., Dunfield,P.F., Dedysh,S.N.,
RA   Liesack,W., Saw,J.H., Alam,M., Chen,Y., Murrell,J.C. and Richardson,P.;
RT   "Complete sequence of plasmid2 of Beijerinckia indica subsp. indica ATCC
RT   9039";
RL   Unpublished
XX
RN   [2]
RP   1-66727
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (11-APR-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-66727
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., LaButti,K., Schmutz,J., Larimer,F.,
RA   Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Dunfield,P.F.,
RA   Dedysh,S.N., Liesack,W., Saw,J.H., Alam,M., Chen,Y., Murrell,J.C. and
RA   Richardson,P.;
RT   "Direct Submission";
RL   Submitted (26-MAR-2008) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001018.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082525
CC   Source DNA available from Peter Dunfield (pfdunfie@ucalgary.ca)
CC   Bacteria available from ATCC: ATCC 9039
CC   Contacts: Peter Dunfield (pfdunfie@ucalgary.ca)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..66727
FT                   /mol_type="genomic DNA"
FT                   /db_xref="ATCC:9039"
FT                   /db_xref="taxon:395963"
FT                   /note="type strain of Beijerinckia indica subsp. indica"
FT                   /strain="ATCC 9039"
FT                   /plasmid="pBIND02"
FT                   /organism="Beijerinckia indica subsp. indica ATCC 9039"
FT   gene            580..1509
FT                   /db_xref="GeneID:6197926"
FT                   /locus_tag="Bind_3876"
FT   CDS_pept        580..1509
FT                   /locus_tag="Bind_3876"
FT                   /gene_family="HOG000057775" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gdi:GDI2531 hypothetical protein"
FT                   /db_xref="GI:182676786"
FT                   /db_xref="GeneID:6197926"
FT                   /translation="MLEDTMLVLPSFSPSTADNGSIGDHVVIDGVSIGLDEIVNSAIFT
FT                   PQTVKNLNKAFLAAKPFPYLVLDGLINPRLLELMLVDFERLNWNDWRRHDNVNEFKRGS
FT                   APNTRFGNASQLYFDTVYSGRFVEFMENVTGIEGLITDPALYSGGLHDIPTGGKFAAHI
FT                   DFNQHRVTRLDNRLVFITYLNKNWRPEYGGELELWDMDKDEPSVRVIPEFGRSVVFLQS
FT                   SKSLHGHPTPVNAPDGRHRRSAATYFYSNVGTAKAGEAYHPTQFGKTVSLVQKQEKLKN
FT                   TLKYFTPPVLIDVVRKLASARHPSKTNR"
FT                   /protein_id="YP_001830894.1"
FT   misc_feature    <856..1326
FT                   /note="2OG-Fe(II) oxygenase superfamily; Region:
FT                   2OG-FeII_Oxy; cl01206"
FT                   /db_xref="CDD:186384"
FT                   /locus_tag="Bind_3876"
FT   gene            complement(1664..2749)
FT                   /db_xref="GeneID:6197925"
FT                   /locus_tag="Bind_3877"
FT   CDS_pept        complement(1664..2749)
FT                   /locus_tag="Bind_3877"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   ppd:Ppro_2100 glycosyl transferase, family 9"
FT                   /db_xref="GI:182676787"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="GeneID:6197925"
FT                   /translation="MKSIGIFQHWGLGDLLMTVPVLSELRRLHPAAQIVLIVRGKAQAA
FT                   LLAKSPLIDKILEVPPNSEKLDLLRFFWSLRQYHFEAVYIGTRITPLVPLLLRLVTGVS
FT                   TIIGDGNRLGWLYTHRNTIDPAVHRVDRMLQTLSLWTGHKVEEPDFPLPIAEEPRRLAM
FT                   ATLEAQGLTNARFFTIHPGSSRGPGIEKRVPVRLVKDVIAGLRKYDPDLRFVILFGPDD
FT                   QDLIPSFTPPEPGISLISGASLDETKFVLSRSWGFLGSDSALGHIAASAYNVPTITPIG
FT                   PTNPLETHPYNALSRIVQSREEFDCRPCWFTPLQGNCPHAARCMTTITVDQILDVVATW
FT                   PKHRISAKSAMVPEPGVHAAE"
FT                   /protein_id="YP_001830895.1"
FT   misc_feature    complement(1721..2749)
FT                   /note="ADP-heptose:LPS heptosyltransferase [Cell envelope
FT                   biogenesis, outer membrane]; Region: RfaF; COG0859"
FT                   /db_xref="CDD:31200"
FT                   /locus_tag="Bind_3877"
FT   misc_feature    complement(<2495..2743)
FT                   /note="Glycosyltransferases catalyze the transfer of sugar
FT                   moieties from activated donor molecules to specific
FT                   acceptor molecules, forming glycosidic bonds. The acceptor
FT                   molecule can be a lipid, a protein, a heterocyclic
FT                   compound, or another carbohydrate...; Region:
FT                   Glycosyltransferase_GTB_type; cl10013"
FT                   /db_xref="CDD:186885"
FT                   /locus_tag="Bind_3877"
FT   misc_feature    complement(1739..>2278)
FT                   /note="Lipopolysaccharide heptosyltransferase is involved
FT                   in the biosynthesis of lipooligosaccharide (LOS).
FT                   Lipopolysaccharide (LPS) is a major component of the outer
FT                   membrane of gram-negative bacteria. LPS heptosyltransferase
FT                   transfers heptose molecules from...; Region:
FT                   GT1_LPS_heptosyltransferase; cd03789"
FT                   /db_xref="CDD:99964"
FT                   /locus_tag="Bind_3877"
FT   misc_feature    complement(order(1949..1951,1958..1963,1970..1972,
FT                   2006..2011,2099..2101,2210..2215))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:99964"
FT                   /locus_tag="Bind_3877"
FT   gene            complement(2746..4068)
FT                   /db_xref="GeneID:6197924"
FT                   /locus_tag="Bind_3878"
FT   CDS_pept        complement(2746..4068)
FT                   /locus_tag="Bind_3878"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="O-antigen and teichoic acid-like export protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rxy:Rxyl_0561 polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="GI:182676788"
FT                   /db_xref="GeneID:6197924"
FT                   /translation="MRYLYPIIFRYASLVLQFVVMVFITRRLSQGDAGIYLQLFGIINA
FT                   TYVFVGFGIPDGIVKSVAHADALDRRHEIRPLVRRAALATGSTSLVMLILGVTAAELFN
FT                   GGYGEDRSLIILAAIWWLCYGATFFAAQVLVALGESGKGAFFFYPAMNIALFGTSVPYL
FT                   ALATTPDIQATLVATIIGGLLCSVAALATAGFYYSTFPSSSEPVSLRPAMRLGFSIGLS
FT                   RVLQSSIHWIPVWGIGAFHGAAAAATLGTASRLNVAIAAVMAAIRFTIRPVIVRHAARN
FT                   DWQEIAIESSKVATLATLVSFVALAGTLLLGPFAIGLIFGESYRASALLLAILLFGTLG
FT                   ECVGGPVDEILKMTSRANIVLAILICATMSEALLVWIFGGFDVIVTAVIQAGTFVGMYG
FT                   FMLWFVWRKHGVWVGANFTPAYIQTLFPRRGAVKGAEDILS"
FT                   /protein_id="YP_001830896.1"
FT   misc_feature    complement(2833..4062)
FT                   /note="Membrane protein involved in the export of O-antigen
FT                   and teichoic acid [General function prediction only];
FT                   Region: RfbX; COG2244"
FT                   /db_xref="CDD:32425"
FT                   /locus_tag="Bind_3878"
FT   gene            complement(4226..5533)
FT                   /db_xref="GeneID:6197923"
FT                   /locus_tag="Bind_3879"
FT   CDS_pept        complement(4226..5533)
FT                   /locus_tag="Bind_3879"
FT                   /gene_family="HOG000224572" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase group 1"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mva:Mvan_1684 glycosyl transferase, group 1"
FT                   /db_xref="GI:182676789"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="GeneID:6197923"
FT                   /translation="MSSHDILFPTEPDVEPAERKLRICIIYGRTPLPMRRADQLTVAHL
FT                   IAFLHARGHAVSLFYLDTGGQATEADREWLRQHTELCQAYKFGRWSVLRGLTRVLTERV
FT                   PVQVGLFSHPQQIREVREHINNNEYDIVYTYYFRSAEVTKGLGFPAGTPKYQRAGRPAS
FT                   FLALQLSQTLNTKRIAKQAPNIPLKLFYEFESRLVERYESHVWRHFTKSVLIGKSDVEE
FT                   IRTACRKNKQPEIDNFVFGAHGTDVTRFTPRKDIQVKPDHLVFSGVMRTPTNVQAVQWF
FT                   AKNAWPAVLQERPNATWAIVGREPSAEVRELGKLPGVTVTGTVPDPALLISEAAVCINP
FT                   MQAGGGMQNKLIEFMASGKAIVATSVANEGVSAPPGTLLIADSPTDFANAVIRLLSDRV
FT                   LAEKLGHAARECILNDWTWKAHFLKLENAFYESIDN"
FT                   /protein_id="YP_001830897.1"
FT   misc_feature    complement(4259..5449)
FT                   /note="sugar transferase, PEP-CTERM/EpsH1 system
FT                   associated; Region: stp1; TIGR03087"
FT                   /db_xref="CDD:163131"
FT                   /locus_tag="Bind_3879"
FT   misc_feature    complement(4244..5410)
FT                   /note="Glycosyltransferases catalyze the transfer of sugar
FT                   moieties from activated donor molecules to specific
FT                   acceptor molecules, forming glycosidic bonds. The acceptor
FT                   molecule can be a lipid, a protein, a heterocyclic
FT                   compound, or another carbohydrate...; Region:
FT                   Glycosyltransferase_GTB_type; cl10013"
FT                   /db_xref="CDD:186885"
FT                   /locus_tag="Bind_3879"
FT   gene            6066..6209
FT                   /db_xref="GeneID:6197922"
FT                   /locus_tag="Bind_3880"
FT   CDS_pept        6066..6209
FT                   /locus_tag="Bind_3880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676790"
FT                   /db_xref="GeneID:6197922"
FT                   /translation="MEPLAPMYERQVKKMRHFNKLMHDADNHDRNSLEFLRAVRIENSL
FT                   MT"
FT                   /protein_id="YP_001830898.1"
FT   gene            6437..7507
FT                   /db_xref="GeneID:6197921"
FT                   /locus_tag="Bind_3881"
FT   CDS_pept        6437..7507
FT                   /locus_tag="Bind_3881"
FT                   /gene_family="HOG000225610" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acyltransferase 3"
FT                   /transl_table="11"
FT                   /note="PFAM: acyltransferase 3; KEGG: rle:RL0234
FT                   exopolysaccharide production protein ExoZ"
FT                   /db_xref="GI:182676791"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="GeneID:6197921"
FT                   /translation="MTVARRRTLTNIQILRGFAAASVALAHAANQFPEVGSIPRIDAAQ
FT                   AGVDVFFVISGFIMVYVTSTRPQTSSQFLLNRASRIVPNYWFYTLATAALAIAAPAVFR
FT                   GTSFNLPHLILSLFFVAHPNPALDDSVSPLLRVGWTLNYEMFFYLIFAIGLLRPQSKVT
FT                   TSVGIIISLVFLGFLLPDPGPVTRFYTRDIMLEFVFGMLLAIAYLRGLPKLPVSLILAA
FT                   CAGAVFFMILSDDVAENTHAVRSIFFGLPALVIVACALMLPDHDDGFGHVILTRIGDAS
FT                   YTIYLCHPFILTLCRVVAVRLGLQPMSLLGNITFMLGATAAATGIGYLAYLFIEVPIGR
FT                   STKRLFIQPRLRAVDP"
FT                   /protein_id="YP_001830899.1"
FT   sig_peptide     6437..6523
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.834 at
FT                   residue 29"
FT                   /locus_tag="Bind_3881"
FT   misc_feature    6524..7486
FT                   /note="Predicted acyltransferases [Lipid metabolism];
FT                   Region: COG1835; cl00792"
FT                   /db_xref="CDD:186190"
FT                   /locus_tag="Bind_3881"
FT   gene            complement(7998..10337)
FT                   /db_xref="GeneID:6197920"
FT                   /locus_tag="Bind_3882"
FT   CDS_pept        complement(7998..10337)
FT                   /locus_tag="Bind_3882"
FT                   /gene_family="HOG000250735" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="exopolysaccharide tyrosine-protein kinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: capsular exopolysaccharide family; PFAM:
FT                   lipopolysaccharide biosynthesis protein; KEGG:
FT                   bra:BRADO7056 putative exopolysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="GI:182676792"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="GeneID:6197920"
FT                   /translation="MLKSVETYRLREQTDISGESARENWNFAHIKAIIERQWKWICGWV
FT                   VAGLVVAALYQLVAPPIYTATTDILTDAPRVSAVSDAYDVTRSASGADTGYTDSQVQIL
FT                   KSERVVLAVIDALNLEKEPSFLPTWIPVITPVVGFVKSTARGIGHLFGMKSDPKDAEYE
FT                   LRRQIVQTLINNVSVQRLGRTFVIEVKFTWRDPVLAAKIANTFAEQYLKDQLKAKYAAA
FT                   ETAGTWLQAHIAELRVKANAADLEVQKFRADHNLQTINGMLVNEDQLSKASAQLADARQ
FT                   KVADAESKKTRIDAILASGDVRSAVTESLSSKVIDALRLKLADASQREQYISQKWGANH
FT                   ASAQNARAEIKNYEALLFEELRHIGETYKSDYEIAKDHLDAINKNVNELMLQASANNEV
FT                   MVHLRELTSEADTLKELYRVNLERYQQTMQQESFPGSTARIIGDAAKPIAVARSPFLVL
FT                   GLGLIGGLFLGCGTALARDALDRRFWTEAQVTSELGLDVLGVLPILPAEKVAAPAQPGR
FT                   AGELGALPTRMKFTLDQSFSMASETMRAVKVAVDISLTGKRPKIIGVISSVSGEGKTIV
FT                   SKNLATLIASHGIKTILIDGDLHRSRLTLALSPTAQVGLTQLLRGVSSLKEVMLVENDS
FT                   GLVFLPGPAGQQLAHPSHLLASEAMGTVLEYLGREGYEYIIVDLPPLDPVVDVRAAAEM
FT                   FDAFVMVVEWGKTTKVQAKAALTKNYTVMRKCIGVVLNKVDLKMMRSFSGMQYTESYYG
FT                   GDLEEESASRRRRGSIYPGGLRRWVR"
FT                   /protein_id="YP_001830900.1"
FT   misc_feature    complement(9714..10253)
FT                   /note="Chain length determinant protein; Region: Wzz;
FT                   cl01623"
FT                   /db_xref="CDD:186458"
FT                   /locus_tag="Bind_3882"
FT   misc_feature    complement(8085..10244)
FT                   /note="exopolysaccharide transport protein family; Region:
FT                   eps_transp_fam; TIGR01005"
FT                   /db_xref="CDD:130078"
FT                   /locus_tag="Bind_3882"
FT   misc_feature    complement(<8544..8657)
FT                   /note="Ras-like GTPase superfamily. The Ras-like
FT                   superfamily of small GTPases consists of several families
FT                   with an extremely high degree of structural and functional
FT                   similarity. The Ras superfamily is divided into at least
FT                   four families in eukaryotes: the Ras...; Region:
FT                   Ras_like_GTPase; cl10444"
FT                   /db_xref="CDD:186996"
FT                   /locus_tag="Bind_3882"
FT   gene            10906..12132
FT                   /db_xref="GeneID:6197919"
FT                   /locus_tag="Bind_3883"
FT   CDS_pept        10906..12132
FT                   /locus_tag="Bind_3883"
FT                   /gene_family="HOG000036322" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative O-acetyl transferase"
FT                   /transl_table="11"
FT                   /note="KEGG: rle:RL3831 putative O-acetyl transferase"
FT                   /db_xref="GI:182676793"
FT                   /db_xref="GeneID:6197919"
FT                   /translation="MKLNSGNSFSLATIEDNRRYYDGFYPGFLLLRHALAFLIIAVHTR
FT                   GLVMGVKHANQFVGQTAPGVSSFSDFIATLFSSAAFRPLGFALVGAFFAVSGFLVSGSA
FT                   IRTGSIRTFLAFRGLRIFPALVSEVTLCALLLGPLTTTVPLSDYFSDPQFRVYFLNILG
FT                   IAHYTLPGVFENNPMPRIINGNLWTLAPEFYCYLIMAVVMMFGIQNKKRLFGLIIVVLT
FT                   LGIFANELTGFLDLPTRAPLVSRFSVWFVVYMFFVGVVFYLFSHKIILNFYLFLACVLG
FT                   YFSLMIIGGFDTISAWLLGYCAIYVGMIDTRWFDRLIRNSDYSYGLYLYGLPIGQLMAL
FT                   LLVVKFGVPQNNGTIILLLTLTIVFTIAFSAVSWTFVERPALKFKRILAAKRPVERQRE
FT                   DIAIEASSS"
FT                   /protein_id="YP_001830901.1"
FT   misc_feature    11116..>11586
FT                   /note="Predicted acyltransferases [Lipid metabolism];
FT                   Region: COG1835; cl00792"
FT                   /db_xref="CDD:186190"
FT                   /locus_tag="Bind_3883"
FT   gene            12727..14580
FT                   /db_xref="GeneID:6197918"
FT                   /locus_tag="Bind_3884"
FT   CDS_pept        12727..14580
FT                   /locus_tag="Bind_3884"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heparinase II/III family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Heparinase II/III family protein; KEGG:
FT                   mva:Mvan_1686 heparinase II/III family protein"
FT                   /db_xref="GI:182676794"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="GeneID:6197918"
FT                   /translation="MVKSKLLKLRRTLVALHYVPLRRILLRGRREMRWRRLLKSPKVAS
FT                   APALSAAQRTQIITLLTTPAFTKAARKIAELTASSFLYEADTDTLIFIASGDRVRIDDI
FT                   DDVAWTKKGGIPASDVNRSFFMSFVEQATLVKGDPRTDLEQIDRYVARLVKAAPIAGTF
FT                   LPIPWHSLTVARRAINLLAALSLLLERDPSLASHMAVTSLIEHIALLEQLIAYLREDDL
FT                   GYNHLASEVFAQCLIAYAFGTDQRFERLIAEFLDVIDAQISADGMQLERSPTYQAHVLG
FT                   HVDVLLAGNILPEAFAPRMRDIASRMREALAILTHPDGGIAVFNDAAVGDGPTPAALGA
FT                   WPRVWSEGVVALPDAGYARLRGGDLVAIFDAGPCGPDDNPGHAHADFLSFELSLGDKRL
FT                   FVDPGVASYKASPERDRCRSAASHNGPTFLGLEPIEFIGPFRVSRRGRAEFFTEASLPK
FT                   IGAPVMAAGWQNGFDPFGGRVSRWLGLWPDSILTSVDLWTGRGDLEAVSTFLVPTIWHI
FT                   QEKDSKRIVFGCEETGERVILRALKGTLAIGHTIKYFPTGPRCPEPAQEVVLHPDGPTS
FT                   DKRVAALMIAKTDAAMDIGLDASALDRVISTLEATQPKRHG"
FT                   /protein_id="YP_001830902.1"
FT   misc_feature    <13498..>14007
FT                   /note="Heparinase II/III-like protein; Region:
FT                   Hepar_II_III; cl02215"
FT                   /db_xref="CDD:154804"
FT                   /locus_tag="Bind_3884"
FT   misc_feature    13786..14211
FT                   /note="Heparinase II/III-like protein; Region:
FT                   Hepar_II_III; cl02215"
FT                   /db_xref="CDD:154804"
FT                   /locus_tag="Bind_3884"
FT   gene            complement(14689..15951)
FT                   /db_xref="GeneID:6197917"
FT                   /locus_tag="Bind_3885"
FT   CDS_pept        complement(14689..15951)
FT                   /locus_tag="Bind_3885"
FT                   /gene_family="HOG000153773" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.132"
FT                   /note="KEGG: bja:blr6296 probable GDP-mannose
FT                   6-dehydrogenase; TIGRFAM: nucleotide sugar dehydrogenase;
FT                   PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="GI:182676795"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="GeneID:6197917"
FT                   /translation="MKIAIYGLGYVGLTAAGCLTKEGHWVLGVDVSEDKIRQIAEGTSP
FT                   IKEPGLAELLQQAVTNNLIKCTSNPGNLINECDMAIVCVGTPSGPDGAHNMSYIAEVSR
FT                   QIAHAVDPDRKDPLTVVFRSTIRPGTIEELILPIFRSVLDSKINAVELVYNPEFLREAV
FT                   AINDFFNPPKIVIGTFDGKPCANMDKMNQNLKAPVFYTRYREAEFTKFVDNTFHAVKVS
FT                   FANEIGRVCLQLGISAQKVHEIFVSDTKLNISPYYLRPGGPFGGSCLPKDVRALQYISS
FT                   DAGAHTHLIDSLLRSNEAHKHYLFEYCLKGVPKDAHILMLGLAFKYDSDDLRESPKVDL
FT                   ARKILVSGYRLSIYDPALKPRDLIGQNLGYVYSQLPNLEKLLVSQSQIEQDRFAVVIDT
FT                   NGSAKTLKLTYDKFIDINALA"
FT                   /transl_table="11"
FT                   /protein_id="YP_001830903.1"
FT   misc_feature    complement(14848..15951)
FT                   /note="nucleotide sugar dehydrogenase; Region:
FT                   NDP-sugDHase; TIGR03026"
FT                   /db_xref="CDD:163112"
FT                   /locus_tag="Bind_3885"
FT   misc_feature    complement(15052..15342)
FT                   /note="UDP-glucose/GDP-mannose dehydrogenase family,
FT                   central domain; Region: UDPG_MGDP_dh; pfam00984"
FT                   /db_xref="CDD:144540"
FT                   /locus_tag="Bind_3885"
FT   misc_feature    complement(<14857..14997)
FT                   /note="UDP-glucose/GDP-mannose dehydrogenase family, UDP
FT                   binding domain; Region: UDPG_MGDP_dh_C; pfam03720"
FT                   /db_xref="CDD:146384"
FT                   /locus_tag="Bind_3885"
FT   gene            16459..17302
FT                   /db_xref="GeneID:6197916"
FT                   /locus_tag="Bind_3886"
FT                   /pseudo
FT   gene            17753..18970
FT                   /db_xref="GeneID:6197915"
FT                   /locus_tag="Bind_3887"
FT   CDS_pept        17753..18970
FT                   /locus_tag="Bind_3887"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   ret:RHE_PA00180 plasmid partitioning protein RepAa1"
FT                   /db_xref="GI:182676796"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:6197915"
FT                   /translation="MAEMDPVDTYRRIADVLRSAQRVAIEIENEPEKRKRLRTFSPQEV
FT                   ATLLRVKPREITAYMKSTSDQLGGARNRLTFSDILQLRKSLHDSSGDLRFFPRRQPERG
FT                   EGLATAVFSNFKGGSAKTTSSVHFAQYMAREGYRVLLIDLDSQGSATAQFGIDPSTEVG
FT                   FENSFTAWTTARETGQEIQASSLCQATYWPSIDLVPAGAVLSQAEESLSRRAANGNVED
FT                   VFYFDELASFLAAVGDNYDIAVVDTRPDVNMLMTIALHAATGLVVPTRATMTDLASTGE
FT                   FFSHLANYIADFKEAFGNGLKVKFTKVMVTAYDPTDRSQEALVGLIRERFGDVVLENEF
FT                   LHSKIMGTAGFGKETLYEYEPSTDRAAYNRVMASVNAVNHAIEREILQSWGRIPGEWFD
FT                   DMEARA"
FT                   /protein_id="YP_001830904.1"
FT   misc_feature    17840..18928
FT                   /note="plasmid partitioning protein RepA; Region:
FT                   partition_RepA; TIGR03453"
FT                   /db_xref="CDD:163271"
FT                   /locus_tag="Bind_3887"
FT   misc_feature    18083..>18193
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bind_3887"
FT   misc_feature    18098..18118
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bind_3887"
FT   misc_feature    18116..18118
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bind_3887"
FT   misc_feature    18437..18610
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bind_3887"
FT   misc_feature    18488..18490
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bind_3887"
FT   gene            18967..20076
FT                   /db_xref="GeneID:6197914"
FT                   /locus_tag="Bind_3888"
FT   CDS_pept        18967..20076
FT                   /locus_tag="Bind_3888"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="parB-like partition protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: ret:RHE_PA00181 plasmid
FT                   partitioning protein RepBa1"
FT                   /db_xref="GI:182676797"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="GeneID:6197914"
FT                   /translation="MNSAKSRFSSLAQAVKERTVESTPSPLDNKQSRLDGAGVHKPVTA
FT                   LGAVGEALRERVGRLETELAETSTANAGLVAELQRVKALSERVGDTAEEFRFLDVDTIV
FT                   DRLPKDRLRGGCQGPEFEELLADIEANGQNDAITVRRSLEGTFEIAAGRRRLEACRLLK
FT                   RSVLARVRDLNDQSMLGVQFSENERRADISALERARWFAEVRERLQIPAKNIAAQFGVD
FT                   PSTFSLYLRLARFPGEILERLQEPRRLAVLPARRVMEAIESDSTALQRILGALDTYQQT
FT                   VSRAETESDPAAQIDVLLQAADSRGGGREGSRSPVPERRSIVHQGRRIGTLTRNGGQWV
FT                   FRFATSIPDSEVLLLAERLALPVSDPDGD"
FT                   /protein_id="YP_001830905.1"
FT   misc_feature    18973..>19689
FT                   /note="plasmid partitioning protein RepB; Region:
FT                   partition_RepB; TIGR03454"
FT                   /db_xref="CDD:163272"
FT                   /locus_tag="Bind_3888"
FT   misc_feature    19264..19524
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Bind_3888"
FT   gene            20270..20704
FT                   /db_xref="GeneID:6197913"
FT                   /locus_tag="Bind_3889"
FT   CDS_pept        20270..20704
FT                   /locus_tag="Bind_3889"
FT                   /gene_family="HOG000001472" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2551 hypothetical protein"
FT                   /db_xref="GI:182676798"
FT                   /db_xref="GeneID:6197913"
FT                   /translation="MPIRAQDRWFYPIDWPQLSIVIRFKRAGGRCEQCGRPHGRLVWCL
FT                   DDGRWWDAESTLWRDSRGRRLRHLPRSQDIFATIRSTKVVLATAHLDHDPSNNSTGNLK
FT                   ALCQRCHLLYDRREHRRRRWLTLHRRKALGDLFLGPYLTR"
FT                   /protein_id="YP_001830906.1"
FT   gene            complement(21264..22511)
FT                   /db_xref="GeneID:6197912"
FT                   /locus_tag="Bind_3890"
FT   CDS_pept        complement(21264..22511)
FT                   /locus_tag="Bind_3890"
FT                   /gene_family="HOG000272414" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="replication protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rpa:pRPA1 replication protein"
FT                   /db_xref="GI:182676799"
FT                   /db_xref="GeneID:6197912"
FT                   /translation="MAKTTRLNLKSRAEFAVLSLHEKNEYIQGIAQHVAHVRGDPYKPL
FT                   DKDALSRIRRYYSRRSLADLRLEQLPDDDLKSSLARLAEAIRSDEVARVISHEVPTEPK
FT                   PIVRAPPLDDSQLSFFVPSIHDAPIKDDFNLMDIAPFALSKTTGEGIIRYELKDSIITV
FT                   EGGAVVGLATAYDYDIVINMISHLADATRQYRIDEAKGLRPSLPPRVYRPAASEILKFC
FT                   RRELGGKQYEDLERALDRLQATRIKITNLSTKDTGRSKRRETESFPLIGRYKVVSRTSH
FT                   DRIDQVEIDIPNWVYEGVVKPDGKPSILTLNPDYFLITRPIAKFLYRLARKAAGQTEAH
FT                   YGLTELHKRSGSKLPRHKFRQAIREIVEAAVPLPDYDLSLIDGETEPVLRMVNRAYDKN
FT                   SVQRSFPDCQNQPLPK"
FT                   /protein_id="YP_001830907.1"
FT   misc_feature    complement(21378..22124)
FT                   /note="Replication initiator protein A; Region: RPA;
FT                   cl02339"
FT                   /db_xref="CDD:154863"
FT                   /locus_tag="Bind_3890"
FT   gene            complement(22914..24491)
FT                   /db_xref="GeneID:6197911"
FT                   /locus_tag="Bind_3891"
FT   CDS_pept        complement(22914..24491)
FT                   /locus_tag="Bind_3891"
FT                   /gene_family="HOG000008988" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: phosphoribosylglycinamide synthetase; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp;
FT                   Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: azc:AZC_3075
FT                   acetyl-CoA carboxylase"
FT                   /db_xref="GI:182676800"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="GeneID:6197911"
FT                   /translation="MFSKILIANRGEIALRVLRAAQELGISTVAVHSTADAEAMHVKLA
FT                   HESVCLGPPPARESYLNIPAIIAACQITGAEAVHPGYGFLSENAHFAEILAAHNIAFIG
FT                   PKPEHIRIMGDKIEAKRTAISLGIPCVPGSSGALNHAEEALDIAEGIGFPVLIKAASGG
FT                   GGRGMKVAHSRDEFASAVATASSEAKAAFGDGSVYLEKYLENPRHIEIQVLGDGRGNAV
FT                   HLGERDCSLQRRHQKVWEESPSPVLDETQREEICEICAVAMRKLGYLGVGTIEFLYKDG
FT                   KFYFIEMNTRIQVEHPVTEMITGFDLVNEQIKIAAGQPLSIIQDQVVVRGHAIECRINA
FT                   EDPTTFTPSPGRIGQYHTPGGIGIRIDSAAYAGYKIPPTYDSLIGKLIVHGPNRKEALM
FT                   RLRRALDEFIVDGIKTTIPLFQRLVNNADIQNGQYSIHWLEAFLAAVAEDVVLTVETNM
FT                   NEAEEADEPDELDAPDGIKVRQSRSVEDPWTGNPPCAIARSTGEPQLPSPNELAYQGHK
FT                   RPSVLRAP"
FT                   /protein_id="YP_001830908.1"
FT   misc_feature    complement(23145..24491)
FT                   /note="acetyl-CoA carboxylase biotin carboxylase subunit;
FT                   Validated; Region: PRK08591"
FT                   /db_xref="CDD:181492"
FT                   /locus_tag="Bind_3891"
FT   misc_feature    complement(24162..24488)
FT                   /note="Carbamoyl-phosphate synthase L chain, N-terminal
FT                   domain; Region: CPSase_L_chain; pfam00289"
FT                   /db_xref="CDD:144029"
FT                   /locus_tag="Bind_3891"
FT   misc_feature    complement(23523..24149)
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="Bind_3891"
FT   misc_feature    complement(23172..23489)
FT                   /note="Biotin carboxylase C-terminal domain; Region:
FT                   Biotin_carb_C; cl08365"
FT                   /db_xref="CDD:158273"
FT                   /locus_tag="Bind_3891"
FT   gene            complement(24719..25777)
FT                   /db_xref="GeneID:6197910"
FT                   /locus_tag="Bind_3892"
FT   CDS_pept        complement(24719..25777)
FT                   /locus_tag="Bind_3892"
FT                   /gene_family="HOG000228612" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="secretion protein HlyD family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   rpe:RPE_3322 secretion protein HlyD family protein"
FT                   /db_xref="GI:182676801"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:6197910"
FT                   /translation="MKTSWLAMVLLTSLGLVAIVWPAQAPTFAQTQPSISPVSRQHLAA
FT                   APGLVEPVSEEREIGSQVIGIIHEVRVEENDEVHEGQIIAVIENDEQVARLSSARAELA
FT                   LRQAELERSINGARSEERKEARAALKEAEANLQLARVEYQRRVPLAKTGASTMAALDVA
FT                   TANLDTTAARREVMAERLALLEAGTRPEDIAAARAQVRLAEANVALADALLDKTLIRSP
FT                   IAGIVLRRVRIAGEAVTNQPPTPIALIGNLHGLRVRAEVDETDVSQATVGQRVEITADA
FT                   FPDQKFGGTVYRVSTRMGAKQVMTGRPADRVDTKVLQVLIDLDPGVRLPIGLRVDAYFL
FT                   SGPSFAEMRPSQ"
FT                   /protein_id="YP_001830909.1"
FT   sig_peptide     complement(25688..25777)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 30"
FT                   /locus_tag="Bind_3892"
FT   misc_feature    complement(24893..25603)
FT                   /note="putative efflux pump membrane fusion protein;
FT                   Provisional; Region: PRK03598"
FT                   /db_xref="CDD:179602"
FT                   /locus_tag="Bind_3892"
FT   gene            complement(25774..26502)
FT                   /db_xref="GeneID:6197909"
FT                   /locus_tag="Bind_3893"
FT   CDS_pept        complement(25774..26502)
FT                   /locus_tag="Bind_3893"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rpe:RPE_3321 ABC transporter related"
FT                   /db_xref="GI:182676802"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:6197909"
FT                   /translation="MKQPVVIASNITHTFGSSTTRFTVLREIDLKIYTNEVLMLVGPSG
FT                   SGKTTLLNILGCLLKPTAGIIDLRGKTTQSLNEEQLASLRLQHFGFVFQAYNLFPVLTA
FT                   TENVMVTLDLLGVKRRAAQERAHELLKLVGLGHRLDSYPAQLSSGQKQRVAIARALASD
FT                   PPILMADEPTAALDAETGLKAMELFCMLAHHQHRAVVIVTHDPRIFPFADRVVHLEDGR
FT                   IVERSSILPDSQSLTMGHSS"
FT                   /protein_id="YP_001830910.1"
FT   misc_feature    complement(25822..26490)
FT                   /note="ABC-type antimicrobial peptide transport system,
FT                   ATPase component [Defense mechanisms]; Region: SalX;
FT                   COG1136"
FT                   /db_xref="CDD:31331"
FT                   /locus_tag="Bind_3893"
FT   misc_feature    complement(25834..26487)
FT                   /note="This family is comprised of MJ0796 ATP-binding
FT                   cassette, macrolide-specific ABC-type efflux carrier
FT                   (MacAB), and proteins involved in cell division (FtsE), and
FT                   release of liporoteins from the cytoplasmic membrane
FT                   (LolCDE).  They are clustered together...; Region:
FT                   ABC_MJ0796_Lo1CDE_FtsE; cd03255"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="Bind_3893"
FT   misc_feature    complement(26356..26379)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="Bind_3893"
FT   misc_feature    complement(order(25891..25893,25990..25995,26221..26223,
FT                   26353..26361,26365..26370))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="Bind_3893"
FT   misc_feature    complement(26221..26232)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="Bind_3893"
FT   misc_feature    complement(26038..26067)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="Bind_3893"
FT   misc_feature    complement(25990..26007)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="Bind_3893"
FT   misc_feature    complement(25972..25983)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="Bind_3893"
FT   misc_feature    complement(25885..25905)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="Bind_3893"
FT   gene            complement(26499..27707)
FT                   /db_xref="GeneID:6197908"
FT                   /locus_tag="Bind_3894"
FT   CDS_pept        complement(26499..27707)
FT                   /locus_tag="Bind_3894"
FT                   /gene_family="HOG000228611" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   rpe:RPE_3320 protein of unknown function DUF214"
FT                   /db_xref="GI:182676803"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="GeneID:6197908"
FT                   /translation="MSSADSVGLLTKSFQRPQAVPRGHSSLTLLIAWRNLVHDRVRFAV
FT                   TLVGIAFSTVLMGIQLGMLLNFMHTTSTIVDQAGADLWVAVQGVRSVDLATPIEERRRF
FT                   QSLAVDGIAKAEPMLLHFGSWKRSNGVRELVLVIGVEPNAEMGLLPSMTPGQNVHDALS
FT                   TPDGVIIDRLYAQKLGVTSIGQIVEINNHRARVAGFTEGIRTFTQAPYVFTSLRNARLL
FT                   SDLGDKDITYVLIKLLEGQAPEPVIRALSTRMPDVDVLPTDEFSHRSRSYWLFTTGAGI
FT                   TLISSSLLALLVGVVIVAQTLYASTLDRLPEYAVVRAMGGPRSYLYKIVIKQAVIGGVL
FT                   GGLTGISVVLLLAYLSRNSSSPPQVPLWLASGIGVITILMCISASLVSLNKVTAIDPVK
FT                   VFR"
FT                   /protein_id="YP_001830911.1"
FT   misc_feature    complement(26502..27635)
FT                   /note="ABC-type transport system, involved in lipoprotein
FT                   release, permease component [Cell envelope biogenesis,
FT                   outer membrane]; Region: LolE; COG4591"
FT                   /db_xref="CDD:34229"
FT                   /locus_tag="Bind_3894"
FT   misc_feature    complement(26505..27617)
FT                   /note="Predicted permease; Region: FtsX; cl11418"
FT                   /db_xref="CDD:187029"
FT                   /locus_tag="Bind_3894"
FT   gene            complement(27966..29342)
FT                   /db_xref="GeneID:6197907"
FT                   /locus_tag="Bind_3895"
FT   CDS_pept        complement(27966..29342)
FT                   /locus_tag="Bind_3895"
FT                   /gene_family="HOG000057776" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase group 1"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mta:Moth_1853 glycosyl transferase, group 1"
FT                   /db_xref="GI:182676804"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="GeneID:6197907"
FT                   /translation="MAQNPTFAFVTIGSGSYLGSTIRDLTLAHSLYKRGFKVVIYWMLE
FT                   HNPDLVINGIEQRILCYGTRYQFKQPSEFLDRIVGPLLSFFPKGWRTNIVQNIPGFVDR
FT                   LLQNLMRSLYTESDPDPSLVKRLLKYVELDGVTHLMMSFGSISPLALEVKKLCKVPLDY
FT                   LVTFQGDEQFADFAAKAGLLQNYRRRLDEAVRNSGWPAIAISRDYLQRLVTELGLDPNC
FT                   FRVIYNGIDLPKQEQRLPFSILKTAFPKVRQDDAQDGAIVTFIGRQESEKGIDLLLYAA
FT                   KLLAVRGVHLQLVICGSTAKGRSYQKVINDLTSHLKLVINHSGAVSFEVRDALYAHSRC
FT                   IVYPSVDREAFGLVVAEAMSQGTPVLVPDIGGVTEVIQHGNIAGGLTFKTWDSADLARQ
FT                   LERLLKDDDLHAELAANTRALAARFSAEHMANNILEHLNLSLNRRFGEEYGSTSRVRAS
FT                   "
FT                   /protein_id="YP_001830912.1"
FT   misc_feature    complement(28116..29195)
FT                   /note="This family is most closely related to the GT1
FT                   family of glycosyltransferases and named after YqgM in
FT                   Bacillus licheniformis about which little is known.
FT                   Glycosyltransferases catalyze the transfer of sugar
FT                   moieties from activated donor molecules to...; Region:
FT                   GT1_YqgM_like; cd03801"
FT                   /db_xref="CDD:99974"
FT                   /locus_tag="Bind_3895"
FT   gene            complement(29474..31363)
FT                   /db_xref="GeneID:6197906"
FT                   /locus_tag="Bind_3896"
FT   CDS_pept        complement(29474..31363)
FT                   /locus_tag="Bind_3896"
FT                   /gene_family="HOG000057777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /transl_table="11"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   sus:Acid_1973 beta-ketoacyl synthase"
FT                   /db_xref="GI:182676805"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="GeneID:6197906"
FT                   /translation="MGTPVPKQPSVGDLPLIGRVFEARAAEELALAVAVHEDLGNPEPP
FT                   IPTPSSTASQPVHTATMDEAQNEAILPFLGPVLAYVPGETITVERHLTLEGDRYLADHA
FT                   FVHAPGVKPASACLPVLPMTMSLEVMAEVAACLVPGYGLLGFEDVKATRWIELADTDVL
FT                   TLHITARVDRHDEDRGASFIRVEVFIEGQTRPAISAMVLFGDHYLIELSPAFTELANPY
FT                   RHPLTGEEIYGERHMFHGPSFHCLSGEIIVGDHGIIGEFVRHSPEDLFGSTRSPQLLID
FT                   PALLDGIGQILGVWAMEHGRYVFPIGLAKLEIYCPSPPVGTRVPVRVEITQTEGKRLLA
FT                   NVEVQDGAGAVWMRIVDWGSWKFNWEQCLVDFRRFPDQYLLGRAAPLPNSGDGSVCLTV
FT                   TTAEFQNFDFSILARHCLSMEEMPVFNGHARIPQRQKQWLLGRVVAKDAVRLWAAEQTQ
FT                   APMLHPAAFTIDNDGQGRPFVRALPGCNTPPLVSIAHSETRAIAVAHTEAVGVDIERIA
FT                   EHDASFIQAFTTAHERNLIAKFPQVEHQTWITRLWCAKEATGKLLGTGINGLPQAFEAI
FT                   QLENGGRIEIKHQTSARSFEVKTVEDCGFIIAYASQPHSSFGHKSESAYTIFG"
FT                   /protein_id="YP_001830913.1"
FT   misc_feature    complement(29852..>30043)
FT                   /note="4'-phosphopantetheinyl transferase superfamily;
FT                   Region: ACPS; cl00500"
FT                   /db_xref="CDD:186039"
FT                   /locus_tag="Bind_3896"
FT   misc_feature    complement(29672..29839)
FT                   /note="4'-phosphopantetheinyl transferase superfamily;
FT                   Region: ACPS; cl00500"
FT                   /db_xref="CDD:186039"
FT                   /locus_tag="Bind_3896"
FT   gene            complement(31406..32626)
FT                   /db_xref="GeneID:6197905"
FT                   /locus_tag="Bind_3897"
FT   CDS_pept        complement(31406..32626)
FT                   /locus_tag="Bind_3897"
FT                   /gene_family="HOG000057778" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chalcone/stilbene synthase domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: chalcone and stilbene synthase domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; KEGG: cph:Cpha266_1099
FT                   3-oxoacyl-(acyl-carrier-protein (ACP)) synthase III
FT                   C-terminal domain protein"
FT                   /db_xref="GI:182676806"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="GeneID:6197905"
FT                   /translation="MSLYNQPVLADFVPVQLVEPTPQAVTLEISAWGFAKTYCRNQGIT
FT                   EKEDFDKVHKEIREKFDNYALSPSVIKRRQLVFFPRMKDIQFSNGEFRLMEPEHEYMKL
FT                   FDNYESLNAKDIKTRHESYAKITDDCLAEMYGDESEAPDDLIHVTCSGYLAPSPAEKLA
FT                   ADKNWFNTTVTHSYHMCCHGAFPAIKMAHGFLSSSQSGVTPPKKRVDIVHTEVLSAHIG
FT                   VENPKVENIITSTLFSDGFIKYSVVSEESLRKRGQHGLKILAFNEHVLPNSAKDMTWMP
FT                   GSTHFHMTLSVMVPVIIKQWVRPFVEALLQQVGIDFERERRHLAFAIHPGGPKIVEHIQ
FT                   DALGLDDDQVAISKSVFAENGNMSSATVPHIFKAIVEEPGIPVGTRIVCLGFGPGLTAS
FT                   GSVLEKI"
FT                   /protein_id="YP_001830914.1"
FT   misc_feature    complement(31418..32398)
FT                   /note="Chalcone and stilbene synthases; plant-specific
FT                   polyketide synthases (PKS) and related enzymes, also called
FT                   type III PKSs. PKS generate an array of different products,
FT                   dependent on the nature of the starter molecule. They share
FT                   a common chemical...; Region: CHS_like; cd00831"
FT                   /db_xref="CDD:29418"
FT                   /locus_tag="Bind_3897"
FT   misc_feature    complement(order(31625..31633,31763..31765,31916..31918,
FT                   32372..32377,32384..32386))
FT                   /note="malonyl-CoA binding site; other site"
FT                   /db_xref="CDD:29418"
FT                   /locus_tag="Bind_3897"
FT   misc_feature    complement(order(31436..31438,31781..31792,31820..31828,
FT                   31832..31834,32033..32041,32048..32050,32057..32062,
FT                   32087..32092,32099..32119,32135..32137,32147..32149,
FT                   32162..32167,32282..32284,32291..32296))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29418"
FT                   /locus_tag="Bind_3897"
FT   misc_feature    complement(order(31541..31543,31640..31642,32084..32086))
FT                   /note="active site"
FT                   /db_xref="CDD:29418"
FT                   /locus_tag="Bind_3897"
FT   misc_feature    complement(order(31445..31447,31535..31537,31763..31768,
FT                   31790..31798,31913..31915,31976..31984))
FT                   /note="product binding site; other site"
FT                   /db_xref="CDD:29418"
FT                   /locus_tag="Bind_3897"
FT   gene            complement(32838..33086)
FT                   /db_xref="GeneID:6197904"
FT                   /locus_tag="Bind_3898"
FT                   /pseudo
FT   gene            complement(33187..34407)
FT                   /db_xref="GeneID:6197903"
FT                   /locus_tag="Bind_3899"
FT   CDS_pept        complement(33187..34407)
FT                   /locus_tag="Bind_3899"
FT                   /gene_family="HOG000057778" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chalcone/stilbene synthase domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: chalcone and stilbene synthase domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; KEGG: cph:Cpha266_1099
FT                   3-oxoacyl-(acyl-carrier-protein (ACP)) synthase III
FT                   C-terminal domain protein"
FT                   /db_xref="GI:182676807"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="GeneID:6197903"
FT                   /translation="MLNYHQPVLADFVPVQLVEPTPQAVTLEISAWGFAKTYCRNQGIT
FT                   EKEGFDKVHKEIREKFDNYALSPSVIKRRQLVFFPRMKDIQFSNGEFRLMEPEHEYMQL
FT                   FDSYDNLNAKDIKTRHDSYAKVATDCLEEMYGDESEAPDDLIHVTCSGYLAPSPVERMV
FT                   SNKNWFNTTVTHSYHMGCYGAFPAIKMAHGFLSSSQFGVTPPKERVDIVHTEVLSAHIG
FT                   VESPKAENIVTMTLFSDGFIKYSVVSEESLRKRGQHGLKILAFNEHVLPNSTSDMTWVP
FT                   GSTRFHMTLSVMVPVIIKQWVRPFVEALLQQVGIDFERERRHLAFAIHPGGPKIVEHIQ
FT                   DALGLDDDQVAISKSVFAENGNMSSATVPHIFKAIVEEPGIPVGTRIVCLGFGPGLTAT
FT                   GLVLEKI"
FT                   /protein_id="YP_001830915.1"
FT   misc_feature    complement(33199..>34038)
FT                   /note="Chalcone and stilbene synthases; plant-specific
FT                   polyketide synthases (PKS) and related enzymes, also called
FT                   type III PKSs. PKS generate an array of different products,
FT                   dependent on the nature of the starter molecule. They share
FT                   a common chemical...; Region: CHS_like; cd00831"
FT                   /db_xref="CDD:29418"
FT                   /locus_tag="Bind_3899"
FT   misc_feature    complement(order(33217..33219,33562..33573,33601..33609,
FT                   33613..33615,33814..33822,33829..33831,33838..33843,
FT                   33868..33873,33880..33900,33916..33918,33928..33930,
FT                   33943..33948))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29418"
FT                   /locus_tag="Bind_3899"
FT   misc_feature    complement(order(33322..33324,33421..33423,33865..33867))
FT                   /note="active site"
FT                   /db_xref="CDD:29418"
FT                   /locus_tag="Bind_3899"
FT   misc_feature    complement(order(33226..33228,33316..33318,33544..33549,
FT                   33571..33579,33694..33696,33757..33765))
FT                   /note="product binding site; other site"
FT                   /db_xref="CDD:29418"
FT                   /locus_tag="Bind_3899"
FT   misc_feature    complement(order(33406..33414,33544..33546,33697..33699))
FT                   /note="malonyl-CoA binding site; other site"
FT                   /db_xref="CDD:29418"
FT                   /locus_tag="Bind_3899"
FT   gene            complement(34444..42468)
FT                   /db_xref="GeneID:6197902"
FT                   /locus_tag="Bind_3900"
FT   CDS_pept        complement(34444..42468)
FT                   /locus_tag="Bind_3900"
FT                   /gene_family="HOG000252008" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="erythronolide synthase"
FT                   /EC_number="2.3.1.94"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   2-nitropropane dioxygenase NPD; KR domain protein;
FT                   Beta-ketoacyl synthase ; Acyl transferase; KEGG:
FT                   sus:Acid_1972 beta-ketoacyl synthase"
FT                   /db_xref="GI:182676808"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="GeneID:6197902"
FT                   /translation="METIVAITPWHTIDPQIAIAASKAGELGILDLGLQDDAAAITAAL
FT                   HQLRSMTGAVGRWGVRWDTFGADSRGLDQLANNLQGEIPVLVLAGLKTHEVLKQLKAAE
FT                   RLAQQVFLEVHDQDTALAAQAAGYAGLIVKGHEAGGQVGKSSSFILLQELRGPIKIPYW
FT                   IQGGISMHSAAAAVLAGATGVVLAEQLWLTQEGPCFSPGQRELWSRLDGSETLTIGRDA
FT                   DLFRLSNRHGRGKLRELELAVAKGAGWQELLQRQLSDHIDPLMPVGQDIAFAGAFGQRY
FT                   VTVGSVIMAMRNAIDASLSQAGSNNHLAPDSPLAKLHGTRYPIVQGPMTRVSDVAPFAK
FT                   AVAEAGGLPFLALAVMRGPQARALLVKAKELMGQRSWGVGILGFMPLDLRQEQMEAVRE
FT                   VKPPFAIIAGGRPSQARELEDLNISTYLHVPSPGLLKEFLKEGARKFIFEGSECGGHTG
FT                   PRTSFTLWGSAIDTLLNAEIKDPESVQVLFAGGIHNAMSAAMVSVMAAPLSERRMKIGV
FT                   LMGTAYLFTQEAVHAGAIVQEFQEQAIACEETAVLQSGVGIYTRCAKTNFCNEFDDKRN
FT                   ELLLDTKSDDQILMELELLNIGRLRIASKGVSRNANSTASDGTDRYTGLDVETQRREGL
FT                   YMMGEVARLRKARVSMAELHNDVSAEATAVLAQAALRQAEHKHPAMPKPHEDIAIVGMA
FT                   SLLPGASDLPSYWQNIMLAVNAIREVPESRWRADDFFDPKRGIKDKVYSRWGGFLDDVA
FT                   FDPTHYGIPPASLRSIEPIQLLALHIASKALEDAGFDRRPFPRERTATIFAASGMNDLG
FT                   MDYIFRTLLTHYLPKVEGVSEDNRKRILDSLCEHDLPKWTEDSFPGMLANVVSGRVANR
FT                   LDLRGTNFTVDAACAASLAALDTGIRQLRSGDADVALVGSVDGANNVLGFMTFAQTHAL
FT                   SPRGRCRPFDDSADGIALGEGVAAVVLKRLTDAERDGDKIYAVIKGIGSSSDGHNRSLT
FT                   APHPQGQVRAIERAYADAGVDPASVTLIEAHGTGTALGDRSEIESLNLAFGTASTQHQY
FT                   CAVGSVKSMIGHTKVTAGLAALIKASLALKHRVLPPTLGVERPSSRVDFPNTPFYINTE
FT                   ARPWLGMPEGQPRRCGVSAFGFGGTNFHTVLEEYRGEYRPSDSQDLNPRAAEIFAFGRA
FT                   KRPEVEQAVRTLLQGLAQPEHLNLAQLAYAVHLDEARVRPKNGALTCQLAIVASSVADL
FT                   KTKLEFFLRESKDKTSIKAPQGIYYREQEHREDSGAVCMLFSGQGSQRINMLRDLVLTR
FT                   PASYALFERADALLKEALPQPLSRYIYPLPSFTKEEQEQQQKALNDTHVAQPALGVIDL
FT                   TALDFLTSFGLRPNFVAGHSYGEYVALCAAGVISRDDLIRLSEVRGRIAAQTSKAESGT
FT                   MAAVNADEARVVEAINRLGLAVSVANLNAPDQTIIAGSAEAIDAAVKALIQESLRIKPI
FT                   AVTAAFHCAAMAEAQEALAAELAKITFQRPQISLFSNTTGNRYPDDPGEIQALLARHIA
FT                   EPLRFVDEIQHLYEAGARVFIEAGPGLVLSGLVDRILGDRPHVSLGIDVPDRPGWLQFA
FT                   HLLAQVFSLGLPINLEPWFQRRGLADTNLEQTLAQARAKAQPGPMVWRVNGGKAVPWYT
FT                   PIQAPSQASTKIPTPPKTPSLSAPSIHKPINTQAAQDGALPNGLARPAINPAAAERASG
FT                   STAAPASQNSFVEREGRPVVSNYDPSSRIAASPPAAYALGSESRFTEVQGSLAQLIDLQ
FT                   RTQQETLRRFFEFQEHWLTGQRPEMTAPSNSVLALANVQPLPAQLPPVPARAPAATIVP
FT                   PAPVLPKFAVAPSPHGAKPTQPAPAAFASPTLNAVPARAPAMSGNGSAKAKNTTDAKAF
FT                   APTEQFKADLLRAASERTGYSEDMLDLDAHMEADLGIDSIKRIEIFSKLKDQYPFMEGR
FT                   AEETVFEELSSLKTLNAVINWYDGLRQTLAKPGGGADPIKIPPLAASVSLLETAAPQNS
FT                   GVGTNGSAADHVILKAKSTTDAHATGEKAFAPTEQFKADLLHAAAERTGYSEDMLDLDA
FT                   HMEADLGIDSIKRIEIFSKLKDQYPFMEGRAEETVFEELSSLKTLNAVIDWYDGLHQSM
FT                   AMPEGADSVKKSQTPSSVSLPEAAESIEIMASADEVQRYTVTPVAAPRDGMAEMNGFPA
FT                   DRLILLVGDVPILGTAFRDRLTAKHYHVRQIVSGTDTHVLDEDRIEVDFSSLDGVSKLR
FT                   ALIAEKGQKVGALFNLAGLGTIADAANDQHLEYARRLFLLLKVLETDLKESAPIGGGWL
FT                   INLTAFDGQFGLRQTRAFPALHAGTLGVAKSVAREWPGIRVKCIDVDPDIDLHHLVTEV
FT                   LREVGNDDQTVEVGFTPKERWKLDLGKGSATAADLSTLDLDSNSVLLVTGGAYGITADV
FT                   TQALAEKFHPRLVLVGRSPMPEEEAKATRDLVEPQQLQQYLIHELRAQNPKTTPAEVNR
FT                   ALKRMLRDRQIRANLAAMRAAGAEVDYHTLDIRDGEAFGRLIDDVYARWGRIDGVLHGA
FT                   GVIDDKSIRDKSPESFDIVFTTKVVPATVLANKLRPEGLKFLMFFSSIAGRFGNAGQSD
FT                   YSAANEVVNKLADRLSHDWPHVHTIAINWGPWDGGMVSDELRRLYATKNIHPIPVAEGR
FT                   QRCLEELGRSNSGKPEIVVAASLQQIAQLALRQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_001830916.1"
FT   misc_feature    complement(<41962..42429)
FT                   /note="TIM barrel proteins share a structurally conserved
FT                   phosphate binding motif and in general share an eight
FT                   beta/alpha closed barrel structure. Specific for this
FT                   family is the conserved phosphate binding site at the edges
FT                   of strands 7 and 8. The phosphate...; Region:
FT                   TIM_phosphate_binding; cl09108"
FT                   /db_xref="CDD:186823"
FT                   /locus_tag="Bind_3900"
FT   misc_feature    complement(41968..41973)
FT                   /note="phosphate binding site; other site"
FT                   /db_xref="CDD:73384"
FT                   /locus_tag="Bind_3900"
FT   misc_feature    complement(40540..41511)
FT                   /note="TIM barrel proteins share a structurally conserved
FT                   phosphate binding motif and in general share an eight
FT                   beta/alpha closed barrel structure. Specific for this
FT                   family is the conserved phosphate binding site at the edges
FT                   of strands 7 and 8. The phosphate...; Region:
FT                   TIM_phosphate_binding; cl09108"
FT                   /db_xref="CDD:186823"
FT                   /locus_tag="Bind_3900"
FT   misc_feature    complement(order(40906..40911,40996..41001))
FT                   /note="phosphate binding site; other site"
FT                   /db_xref="CDD:73384"
FT                   /locus_tag="Bind_3900"
FT   misc_feature    complement(39055..40413)
FT                   /note="polyketide synthases (PKSs) polymerize simple fatty
FT                   acids into a large variety of different products, called
FT                   polyketides, by successive decarboxylating Claisen
FT                   condensations. PKSs can be divided into 2 groups, modular
FT                   type I PKSs consisting of one or...; Region: PKS; cd00833"
FT                   /db_xref="CDD:29420"
FT                   /locus_tag="Bind_3900"
FT   misc_feature    complement(39046..40407)
FT                   /note="Beta-ketoacyl synthase; Region: PKS_KS; smart00825"
FT                   /db_xref="CDD:129058"
FT                   /locus_tag="Bind_3900"
FT   misc_feature    complement(order(39289..39291,39409..39411,39814..39816))
FT                   /note="active site"
FT                   /db_xref="CDD:29420"
FT                   /locus_tag="Bind_3900"
FT   misc_feature    complement(37792..38679)
FT                   /note="malonyl CoA-acyl carrier protein transacylase;
FT                   Region: fabD; TIGR00128"
FT                   /db_xref="CDD:161724"
FT                   /locus_tag="Bind_3900"
FT   misc_feature    complement(37792..38673)
FT                   /note="Acyl transferase domain; Region: Acyl_transf_1;
FT                   cl08282"
FT                   /db_xref="CDD:186816"
FT                   /locus_tag="Bind_3900"
FT   misc_feature    complement(34525..>36927)
FT                   /note="polyketide-type polyunsaturated fatty acid synthase
FT                   PfaA; Region: omega_3_PfaA; TIGR02813"
FT                   /db_xref="CDD:163029"
FT                   /locus_tag="Bind_3900"
FT   misc_feature    complement(36166..36396)
FT                   /note="Phosphopantetheine attachment site; Region:
FT                   PP-binding; cl09936"
FT                   /db_xref="CDD:186876"
FT                   /locus_tag="Bind_3900"
FT   misc_feature    complement(34621..35298)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bind_3900"
FT   gene            43665..43868
FT                   /db_xref="GeneID:6197901"
FT                   /locus_tag="Bind_3901"
FT   CDS_pept        43665..43868
FT                   /locus_tag="Bind_3901"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676809"
FT                   /db_xref="GeneID:6197901"
FT                   /translation="MLGPTLCGQVLSRVKTYVLYTLTNCAALWAAQSWLVYARRPCVLI
FT                   VSCACRKARAKPLRFLAIFQDG"
FT                   /protein_id="YP_001830917.1"
FT   gene            44081..44350
FT                   /db_xref="GeneID:6197900"
FT                   /locus_tag="Bind_3902"
FT   CDS_pept        44081..44350
FT                   /locus_tag="Bind_3902"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676810"
FT                   /db_xref="GeneID:6197900"
FT                   /translation="MASAVPMAASSSPMDSLAAGAALRGLYLSTKPEDYFPSGPVAISG
FT                   HSAKPMLEKDHRVIENKRAIYVKLSLNKLFFWLQEAGWLVEPLT"
FT                   /protein_id="YP_001830918.1"
FT   sig_peptide     44081..44137
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.755) with cleavage site probability 0.640 at
FT                   residue 19"
FT                   /locus_tag="Bind_3902"
FT   gene            44364..44780
FT                   /db_xref="GeneID:6197899"
FT                   /locus_tag="Bind_3903"
FT   CDS_pept        44364..44780
FT                   /locus_tag="Bind_3903"
FT                   /gene_family="HOG000057674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676811"
FT                   /db_xref="GeneID:6197899"
FT                   /translation="MTVSSIDQVRSEIASLEERLEKLRQVESILAELSGEGVSQPSPRK
FT                   SRVSARQQMERRPEKLTQPVGRRRGAKLQGREGSTPNAILSLLETQGPLARAEIEEAIR
FT                   AEREIGKQTVSVSLQRLRGSGKIQLEDGKWGLAA"
FT                   /protein_id="YP_001830919.1"
FT   gene            45462..47108
FT                   /db_xref="GeneID:6197898"
FT                   /locus_tag="Bind_3904"
FT   CDS_pept        45462..47108
FT                   /locus_tag="Bind_3904"
FT                   /gene_family="HOG000204545" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   mpt:Mpe_A1351 steroid monooxygenase"
FT                   /db_xref="GI:182676812"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:6197898"
FT                   /translation="MTHSATMEKVENGSSERLTLDAIVIGAGVAGLYQLYRLREQGLKV
FT                   KVFETASNVGGTWYWNRYPGARFDSEAYIYQYFFSEDLYKGWSWSERFPAQPEIERWLN
FT                   YVADRCDLRKDVYFNTTIKSAHFNEGTERWILETDAGLTIDAQFVITCCGMLSAPLTST
FT                   FAGQDTFKGQLFHTARWPKEPVDFSGKRVGIIGNGATGIQVIQTIADKVGHLKVFMRTP
FT                   QYIIAMRNPKYGNEEVAAYKDRFHELAKTLPHTFSGFEYSFENGAWADLLPEQRREILE
FT                   TIWNDGSLKLWLASFSELFYDQSVCDEISEFVREKMRERITDPKLRDLLIPSDYGFGTH
FT                   RVPLETNYLEAYLQPNVEIVSVKNNPIECVTPEGIKTADGTVHALDIIILATGFDAGSG
FT                   ALTRIDIRGRGARSLKEDWSRDIRTNMGLQIYGYPNLFTTGAPLAPSAALCNMTTCLQQ
FT                   QVDWISNCIKYLHDNNLKVIETTKEAEDQWVKHHDDIANKTLMTKTNSWYMGSNVEGKP
FT                   RRLLSYIGGVGAYRQKCDEVAAEAYRGFIMS"
FT                   /protein_id="YP_001830920.1"
FT   misc_feature    45519..46808
FT                   /note="Predicted flavoprotein involved in K+ transport
FT                   [Inorganic ion transport and metabolism]; Region: TrkA;
FT                   COG2072"
FT                   /db_xref="CDD:32255"
FT                   /locus_tag="Bind_3904"
FT   misc_feature    45531..>46088
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="Bind_3904"
FT   gene            47198..48391
FT                   /db_xref="GeneID:6197897"
FT                   /locus_tag="Bind_3905"
FT   CDS_pept        47198..48391
FT                   /locus_tag="Bind_3905"
FT                   /gene_family="HOG000042598" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="beta-lactamase"
FT                   /transl_table="11"
FT                   /note="PFAM: beta-lactamase; KEGG: dsh:Dshi_2284
FT                   beta-lactamase"
FT                   /db_xref="GI:182676813"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="GeneID:6197897"
FT                   /translation="MLAELKTSADVILDNAVTSQPSVAGVVAMITDRHHTIYEGAAGKR
FT                   RLDRDAGMTSDSVFALFSTTKAITATAVLQLVEEGRLDLDAPASHYSPDIGKLQVIEGF
FT                   EETGAPKLRAPKRSITTRMLMLHTGGFGYDFFNETYNRLARERGQPSVVTASKAALMTP
FT                   LLFDPGERWEYGTNIDWCGQIVEGITGKRLGQVFKERIFDPLGMQNSTFELTDAMRSKL
FT                   AIVHARNSDGSLTPMDFELPPQPEVHMGGHGLYGTVGDYMRFIRMWLNDGAGEHGRVLK
FT                   AETVRMAEKNHLGDKKISPLPGVIPALSNDAEFFPGAPKSWSFSFMVNDEEAPTGRPAG
FT                   ALGWAGLANLFYWIDRKNGFGGFWATQILPFADPVSFSAYLDFESAFYASLKQRNVA"
FT                   /protein_id="YP_001830921.1"
FT   misc_feature    47255..48358
FT                   /note="Beta-lactamase; Region: Beta-lactamase; cl01009"
FT                   /db_xref="CDD:186300"
FT                   /locus_tag="Bind_3905"
FT   gene            complement(48545..50587)
FT                   /db_xref="GeneID:6197896"
FT                   /locus_tag="Bind_3906"
FT   CDS_pept        complement(48545..50587)
FT                   /locus_tag="Bind_3906"
FT                   /gene_family="HOG000058487" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sigma-54 factor interaction domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; GAF domain protein;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase; KEGG: xau:Xaut_1337 GAF modulated
FT                   sigma54 specific transcriptional regulator, fis family"
FT                   /db_xref="GI:182676814"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="GeneID:6197896"
FT                   /translation="MSRTAMNQTFSVPEKDPDIMASWERFMNGDVSATSSLRDLIDQSW
FT                   RRCHDADIDHRRNQAPPPVKQDTLHALRDECAELIEASAPVMASARDFLGETSTVMVLT
FT                   NSTGLILSQEGDVSLRGAAENVHLLPGANWSEFTCGTNAIGTAIEIGRPIQIHSNEHYC
FT                   SGIKRWSCSASIIKNPCDGSTLGVIDVSGLSHSYSRHSLALVVATAGRIESRIAQMEMD
FT                   LRYRLLEGCMDRLTAHSTDGIVVLDRHGRAIKANTHAAVMLADLGAPQSLTRNNLFSLT
FT                   LDWRRGHDLPEHLPPWIQKEWLTPMNAGGKRLGVILTIPNRQGASAKLARASTRIALPP
FT                   SEPERTRIFPKLVGQAPALLLAAARARQIAKSSVPVLLLGETGVGKEVFARDLHEASAV
FT                   GKGPFIALNCGGLSRDLLTSELFGYAEGSFTGARRGGMMGKIEAANGGTLFLDEIGELP
FT                   TDLQPLFLRVLEEREICRIGEVQPRKVNFRLVAATNRDLRMETQASRFRMDLYYRLSVI
FT                   SITIPPLRERSEDIPLLAEHFTALFTKQYGLPSRHISADIMNALQQHDWPGNIRELRNV
FT                   IEGILLTSANETLTKADLPPEFSALTNKLPSTGNSDTSSSALTPIENAERETIVRMLRT
FT                   HHGNMTAVARELGIAKSTLYVKMKIFQLENIAHDLRASSGNIKPY"
FT                   /protein_id="YP_001830922.1"
FT   misc_feature    complement(48599..50542)
FT                   /note="Transcriptional activator of acetoin/glycerol
FT                   metabolism [Secondary metabolites biosynthesis, transport,
FT                   and catabolism / Transcription]; Region: AcoR; COG3284"
FT                   /db_xref="CDD:33094"
FT                   /locus_tag="Bind_3906"
FT   misc_feature    complement(49019..49477)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bind_3906"
FT   misc_feature    complement(49427..49450)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bind_3906"
FT   misc_feature    complement(order(49106..49108,49232..49234,49424..49447))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bind_3906"
FT   misc_feature    complement(49229..49246)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bind_3906"
FT   misc_feature    complement(49049..49051)
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bind_3906"
FT   misc_feature    complement(48605..48727)
FT                   /note="Bacterial regulatory protein, Fis family; Region:
FT                   HTH_8; cl01091"
FT                   /db_xref="CDD:186327"
FT                   /locus_tag="Bind_3906"
FT   gene            complement(51254..51892)
FT                   /db_xref="GeneID:6197895"
FT                   /locus_tag="Bind_3907"
FT   CDS_pept        complement(51254..51892)
FT                   /locus_tag="Bind_3907"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="regulatory protein TetR"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pla:Plav_0612
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="GI:182676815"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:6197895"
FT                   /translation="MVLCYDRSMATIASVTASGSKADQIIAATRSLFVRYGYRRTSVDD
FT                   IAREAGVAKATLYLHFSGKEEMFREMIRRFQLLQEERCAAAEAIETSVENKIVALIDAV
FT                   YGTTIEWFENTAHIEELKSVALHEISVPVDEPVQAFRRRLTRMIKAAEERGELRLSAVG
FT                   SSAQDVAQVLLFAAYGAKHAAHATHASFHAALPGIVRLILVGMIPADIA"
FT                   /protein_id="YP_001830923.1"
FT   misc_feature    complement(51371..51868)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="Bind_3907"
FT   misc_feature    complement(51680..51820)
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Bind_3907"
FT   gene            51959..52688
FT                   /db_xref="GeneID:6197894"
FT                   /locus_tag="Bind_3908"
FT                   /pseudo
FT   gene            52727..53650
FT                   /db_xref="GeneID:6197893"
FT                   /locus_tag="Bind_3909"
FT   CDS_pept        52727..53650
FT                   /locus_tag="Bind_3909"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   osa:4324493 Os01g0151700"
FT                   /db_xref="GI:182676816"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:6197893"
FT                   /translation="MTDRIDALGFGRRSTAEQVTEGVDLSGRTILLTGCNSGIGMETMR
FT                   VLAARSARIVAVARNEEKARGALASAGAADGLAIGAEFTDLASVARAADQVLASGVVLD
FT                   TIITNAAIMALPKLETVNGIEKQFLVNHVAHHLLVTRLLPAIRRSSAGRIVVVASNSHN
FT                   FAPRGKGIDFDNLDGGKSYGGFRFYGQAKLANILFANELSRRLANDGITANALHPGLIG
FT                   ATGLHRHMRGPIDWAVSIAMMFGKTVPQGAATTCLLAAHPALEGISGRYFADCRAAKSS
FT                   AFARDAGLARRLWGRTEEIIASFGVA"
FT                   /protein_id="YP_001830924.1"
FT   misc_feature    52727..53632
FT                   /note="oxidoreductase; Provisional; Region: PRK06196"
FT                   /db_xref="CDD:180460"
FT                   /locus_tag="Bind_3909"
FT   misc_feature    52796..>53386
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bind_3909"
FT   gene            53734..54481
FT                   /db_xref="GeneID:6197892"
FT                   /locus_tag="Bind_3910"
FT                   /pseudo
FT   gene            complement(55063..55344)
FT                   /db_xref="GeneID:6197891"
FT                   /locus_tag="Bind_3911"
FT   CDS_pept        complement(55063..55344)
FT                   /locus_tag="Bind_3911"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676817"
FT                   /db_xref="GeneID:6197891"
FT                   /translation="MSLKEPHQTTYWFLLMSICIMAVSLAGSMSAHSQPSPIGQVQELT
FT                   EEAYQVPGTLIIREGRSAIPGDQNYFWPDSAAIDPKPSHQRKHPYHKH"
FT                   /protein_id="YP_001830925.1"
FT   sig_peptide     complement(55243..55344)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 34"
FT                   /locus_tag="Bind_3911"
FT   gene            complement(55697..57124)
FT                   /db_xref="GeneID:6197890"
FT                   /locus_tag="Bind_3912"
FT   CDS_pept        complement(55697..57124)
FT                   /locus_tag="Bind_3912"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_6395 hypothetical protein"
FT                   /db_xref="GI:182676818"
FT                   /db_xref="GeneID:6197890"
FT                   /translation="MSRLLRGFAYKVAKYSVPCAIALLPGSAMAQYFQINQGEYPTMFT
FT                   DRDYSKLADPANRKTLLDNIHYIPLGIPGTSYLTLGGAIREQGWWYRNLRQGFPTSPQN
FT                   KNDTLLNSRITVSAWYHVDQHLSMLVELGSYFSPGRNKPYGANDVAPARIQNLFVDYTQ
FT                   KVGPLDIAARLGRQEFLFGSGRFLWNGNANNITTAVDGALVQATWDKGYRLQMFSARPT
FT                   VTTTTAFQDGSYTQELSGVYITTPVIDKVLNVDEYYYYWRRPNVSLAGRSGTEQGDMVA
FT                   GRVYGRVDDFRYDVDFGYKFGQFAHTRVGAVGTLGRVTYTFSKAEWQPIVQLQGGYFSG
FT                   SNGYKSSTIGTFTAPFPRSAQLTYASFNAYSNMIHVAPALILNPTKEFAVRFGPQFNWR
FT                   ASVNDYVYIPAQTPLTATRNNKASYIGTNMIGGVSWLLNSNTQVYVEYIHAFAGPAITL
FT                   SGGKSSDAGVFQVEFSF"
FT                   /protein_id="YP_001830926.1"
FT   sig_peptide     complement(57032..57124)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 31"
FT                   /locus_tag="Bind_3912"
FT   gene            complement(58108..59532)
FT                   /db_xref="GeneID:6197889"
FT                   /locus_tag="Bind_3913"
FT   CDS_pept        complement(58108..59532)
FT                   /locus_tag="Bind_3913"
FT                   /gene_family="HOG000057624" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rsq:Rsph17025_2588 Ig family protein"
FT                   /db_xref="GI:182676819"
FT                   /db_xref="GeneID:6197889"
FT                   /translation="MSFARFKLAFAGLTLLSATHAAAETHWSLARIVNVAAGGTSLSTN
FT                   TFAQTSTGTYSDTYWTRIYLTPLSNLLGWNYASPRSWAIGGNTLAQVLTNYTSSSATPS
FT                   DRRWGPLIKWHPDIFFSEGASNDLGRPLESMKADAEAVQAALLSISPTPPRILNENIWP
FT                   RTHLSHPATTYPARLNFNAWHSSQSHANKYLKSIDFDELLQDPQNPGTFNPAYTFDGVH
FT                   PNVSGSLRVADYIFSQLRHIDMLPAPVVFPFTLDAAADPTNLLQNAATPNSAKQLFGGA
FT                   DGVATNFTGKVPTGWIATANASWNGSAGSLPAITTEPDGAYRKKVVITVPNGSAPSSNA
FT                   ATWLNLSTSGTIIPTASAASSGISPGNSYRAGITIELANGKNIVPVGFFMTFKIDGVTT
FT                   IETTFATAAYTKNDTMPDGTYNLLSPVFTVPDHFSTIELSSLKICFGSVSGAAAGGTIK
FT                   ISKPYIRQFKYLASWP"
FT                   /protein_id="YP_001830927.1"
FT   sig_peptide     complement(59461..59532)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.658 at
FT                   residue 24"
FT                   /locus_tag="Bind_3913"
FT   misc_feature    complement(58816..59316)
FT                   /note="SGNH_hydrolase, or GDSL_hydrolase, is a diverse
FT                   family of lipases and esterases. The tertiary fold of the
FT                   enzyme is substantially different from that of the
FT                   alpha/beta hydrolase family and unique among all known
FT                   hydrolases; its active site closely...; Region:
FT                   SGNH_hydrolase; cl01053"
FT                   /db_xref="CDD:186311"
FT                   /locus_tag="Bind_3913"
FT   misc_feature    complement(order(58867..58869,58876..58878,59155..59157,
FT                   59275..59277))
FT                   /note="active site"
FT                   /db_xref="CDD:58496"
FT                   /locus_tag="Bind_3913"
FT   misc_feature    complement(order(59155..59157,59275..59277))
FT                   /note="oxyanion hole; other site"
FT                   /db_xref="CDD:58496"
FT                   /locus_tag="Bind_3913"
FT   misc_feature    complement(order(58867..58869,58876..58878))
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:58496"
FT                   /locus_tag="Bind_3913"
FT   gene            60316..61548
FT                   /db_xref="GeneID:6197888"
FT                   /locus_tag="Bind_3914"
FT   CDS_pept        60316..61548
FT                   /locus_tag="Bind_3914"
FT                   /gene_family="HOG000036322" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acyltransferase 3"
FT                   /transl_table="11"
FT                   /note="PFAM: acyltransferase 3; KEGG: cak:Caul_3692
FT                   acyltransferase 3"
FT                   /db_xref="GI:182676820"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="GeneID:6197888"
FT                   /translation="MTLEETMNANKGIGPGFHLLRHVLAALILIYHCTIAVFGAHTNDY
FT                   MGKGLLLAQKAGHDLTMPQLLMEVIRPTLYTLVGMFFALSGFLVTSSALRNGNIKVFFL
FT                   NRAVRIIPALSVEITLSALILGPLVTNLPLGQYFSDPRFFRYFGNIAGFVTFTLPGVFT
FT                   DNPWPNIVNLNLWTLPPEFWCYLLMLGLMISGLLSKQKLLTAGIIFAIFVATALDIFDH
FT                   HTFTIKENNTRFTVWYIVMMFFIGMLFCVNAKHVILNVWLALGCALGFYVLTLSDSFGP
FT                   LSGLLLTYLTAYIGMIRFPLFDRILKEDLSYGIYLYGFPLTQVTIFFLLPHLGFLPGGI
FT                   RLAIITLISFCLTLIFASLSWKFIEKPALRLRKWGQKKSVPISADEHGPAQSVPEGLVP
FT                   VTDETSLRPAQ"
FT                   /protein_id="YP_001830928.1"
FT   misc_feature    60547..61434
FT                   /note="Predicted acyltransferases [Lipid metabolism];
FT                   Region: COG1835; cl00792"
FT                   /db_xref="CDD:186190"
FT                   /locus_tag="Bind_3914"
FT   gene            complement(61700..63064)
FT                   /db_xref="GeneID:6197887"
FT                   /locus_tag="Bind_3915"
FT   CDS_pept        complement(61700..63064)
FT                   /locus_tag="Bind_3915"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: shn:Shewana3_1383 hypothetical protein"
FT                   /db_xref="GI:182676821"
FT                   /db_xref="GeneID:6197887"
FT                   /translation="MVISSVIPGLFLVAYGIYIINSCRGVDFYIDYTLWVLVWGALFTL
FT                   NGLLGGPFIQSTLTNIIIIELILSFMAGHKILTLMRECRPVSRETPPTPNISAFVSLCA
FT                   LAGLWSPYEILKGGAGDLLNDDYAETIRDINSEIRTGGIESGMLGKIAFAMPQAAIVLV
FT                   GVCSVIGRYQWMRRAILVIVSLFPLFVLTFVSTIRSPVFMSLLLLVSGIIAGQTLLGTE
FT                   RSIFSKRNTIAATVLVFGLVSMMAFLQSIRLGDFNFSQIGETLEHMRIWFAGYIPAFHG
FT                   WYWNYWSGDLAYGNNTFKFLAGLITGGGSYLDTVQSNIDIGDWRDGNASTALRVMVNDF
FT                   GLIGCGIFLFTWGVISAFLVQKTREGSLYWAALLAYDIASVVWSPNQWYFVYGSRVLAP
FT                   IVVLTYLAIMSDRRQRKSARHFHEPDHAMRNAATEGRAGYARPNFIATPPRGSRI"
FT                   /protein_id="YP_001830929.1"
FT   gene            complement(63117..63254)
FT                   /db_xref="GeneID:6197886"
FT                   /locus_tag="Bind_3916"
FT   CDS_pept        complement(63117..63254)
FT                   /locus_tag="Bind_3916"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676822"
FT                   /db_xref="GeneID:6197886"
FT                   /translation="MSHLLTSKMGKRDNAENLLHNRHVAYFRHGWCDIASDESIATGWR
FT                   "
FT                   /protein_id="YP_001830930.1"
FT   gene            complement(63349..64491)
FT                   /db_xref="GeneID:6197885"
FT                   /locus_tag="Bind_3917"
FT   CDS_pept        complement(63349..64491)
FT                   /locus_tag="Bind_3917"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase group 1"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   cch:Cag_1473 hypothetical protein"
FT                   /db_xref="GI:182676823"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="GeneID:6197885"
FT                   /translation="MDSRKRLVMFAKGYLPTDGGIERYSTELARAYAKQGWRLYVLTQS
FT                   SAEPGIRRDGAVTVLDFGKGQQAMLLLRFTCAWRVLRKRLRPDFIHATTWRLALPALLN
FT                   RRQQPLVVTVHGREIFIVSPLLRIVMRYVFARVDSVVVVSDVIRRLAASQANLITDNWT
FT                   VVWNGVSLNNDHGFTPHPPVMAGAPVRLLSLCRLVPRKNILGAVRAMALLVESGMNGFI
FT                   YEIAGNGPDYDAIQALINKRGLKPYVRLLGRVDDADMPALYHAADIFLHPQIDLSGDVE
FT                   GFGLTIADAMSFGAAVVAGRDGGPADFVIDGATGLLVDGTKDTEIAKAIKLLIDNPALR
FT                   TKLGEAAERWVHDHLSWSAAAERIIETLPDARSKPVQGTG"
FT                   /protein_id="YP_001830931.1"
FT   misc_feature    complement(63370..64479)
FT                   /note="Glycosyltransferase [Cell envelope biogenesis, outer
FT                   membrane]; Region: RfaG; COG0438"
FT                   /db_xref="CDD:30787"
FT                   /locus_tag="Bind_3917"
FT   misc_feature    complement(63388..64476)
FT                   /note="This family is most closely related to the GT1
FT                   family of glycosyltransferases and named after YqgM in
FT                   Bacillus licheniformis about which little is known.
FT                   Glycosyltransferases catalyze the transfer of sugar
FT                   moieties from activated donor molecules to...; Region:
FT                   GT1_YqgM_like; cd03801"
FT                   /db_xref="CDD:99974"
FT                   /locus_tag="Bind_3917"
FT   gene            65181..66692
FT                   /db_xref="GeneID:6197884"
FT                   /locus_tag="Bind_3918"
FT   CDS_pept        65181..66692
FT                   /locus_tag="Bind_3918"
FT                   /gene_family="HOG000057737" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676824"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="GeneID:6197884"
FT                   /translation="MTAGLLVTSQRALAETPKPLRISEFVTAHADDTNPVLHRAAEEAV
FT                   ARNTPLYIDQPVTFQLRWTPPKGLVLRGDGSERSRLDWKGQGDAVEVTQPFDIDGITID
FT                   GGLDPRSDRSVGSFGCLFSIHGPMKGSPAYLSGIRIGHLRVRRTRSVGIVLANIENLTA
FT                   GQIFVEDIFCNGLILSGLRNCDITQVTASNIGDLKGTGHRRGSAVAIFSETKPVASWYD
FT                   TQRILPTDHLHIGHAEIAKTTDSAFYIHDDLQTGVHDVTIDSVHVDTAGKDGFKTRAGP
FT                   RTVRVGTVTVERSSLRGVDIESDDVKIEQIDVSHIGFDAVGAILGHPAPFSGRDATNES
FT                   IQTHPNGLVIMGCSDVEIQRMKIADVASNPVTGAEGHGVHISRAHRFKVKGDVIRCDGN
FT                   GLRLSGSSDFDIELDITDPCRGRLTQQAILLTPDKAGPNYDGTIRSQITHTSMNPPRFA
FT                   LDIDDSCGINATIKIRPDNPSDGSMVIRDNSRKTCGAYSNDIKRR"
FT                   /protein_id="YP_001830932.1"
SQ   Sequence 66727 BP; 14920 A; 17808 C; 18437 G; 15562 T; 0 other;
     GTCTCGTCAG GCAAGATGAT TTAATTGATC GCCCCTCGGA AAACTGGCAC CGAGAGGTTC        60
     CAACAGAAAC GTCCAAGCGA TCGCATGAGA CAAATTGTCG CTGGAATTTC CGGAGGTCCC       120
     TTAGAATGGG GCCCTTGTCA AGGTTTGCGC TATATAGTGC TTACTGCTCC GTAGGAGCCC       180
     AGCGGATTGA TTTACCTCAA GAAGTTCGTT TCCTGTAACA CAGCACTAGA GCGCTTGCAT       240
     CCATCGCTAG CGGCTAGATG CTCAATTGAA TTATGGCATT TTCATGGAGA TTCTATGATC       300
     TCAGTTTCTA TATCATTTAT TTTTCAATAA ATTGATAATG GCATGGATTG CATTTCTGCC       360
     ATAGTTTTAA TATCGTGAAT AAAAAATTAT ATAGTGTCAA TTGAAGTCCG CAAGATTTAG       420
     GTAAAAATTC TTGGCGTTCA TTAAGGCATC AATTTATAAT GATGCCCGCA GGTTTGTGTT       480
     CAATAAATAG TATATTATCG CTGTAAATGG CTTAATATAA TTAGTTTATA TTATGAGTTT       540
     ACATGTTATA ATTTGTATAG TATCGGGAGA TGGTTATCTA TGCTTGAAGA TACTATGCTT       600
     GTTCTGCCGA GCTTCTCTCC CTCCACCGCA GATAACGGAT CCATAGGCGA TCACGTCGTG       660
     ATCGACGGGG TCTCTATTGG CCTCGACGAG ATCGTCAATT CTGCCATTTT CACCCCGCAG       720
     ACCGTGAAAA ACCTCAACAA AGCGTTCCTC GCGGCGAAGC CCTTTCCATA TCTCGTCCTC       780
     GACGGCCTCA TCAACCCGCG CCTGCTCGAA CTGATGCTCG TCGATTTCGA GCGCCTCAAC       840
     TGGAACGATT GGCGTCGCCA CGACAATGTC AATGAGTTCA AGCGCGGATC CGCGCCGAAC       900
     ACACGGTTCG GCAATGCCAG CCAACTTTAT TTCGATACGG TCTATTCTGG CCGTTTTGTC       960
     GAATTTATGG AAAATGTAAC AGGAATTGAA GGTCTTATTA CGGACCCTGC GCTCTATAGT      1020
     GGGGGGCTCC ATGATATTCC GACTGGTGGC AAATTCGCAG CCCATATCGA CTTCAACCAA      1080
     CATCGCGTGA CACGGCTCGA CAACCGTCTT GTCTTCATTA CCTATCTCAA TAAGAATTGG      1140
     CGTCCCGAAT ATGGCGGCGA GCTCGAGCTT TGGGATATGG ACAAGGATGA GCCATCTGTC      1200
     CGCGTCATTC CGGAATTTGG CCGGTCGGTC GTGTTCTTAC AATCCTCCAA GAGCCTTCAT      1260
     GGCCATCCAA CGCCTGTGAA CGCTCCGGAC GGGCGCCACC GGAGGTCAGC GGCCACCTAT      1320
     TTCTACAGCA ACGTAGGCAC TGCCAAGGCC GGGGAAGCCT ATCACCCGAC CCAGTTCGGC      1380
     AAAACTGTCT CATTGGTGCA GAAACAGGAA AAATTGAAGA ATACGCTCAA ATATTTCACG      1440
     CCACCCGTTC TGATAGATGT TGTGCGTAAA TTGGCATCTG CGCGACATCC TAGCAAAACC      1500
     AATCGCTAGA GCATTAGACC AAAAAAGACG CCCTTTTTGG AAGAATTTGG GGCTTCAATA      1560
     ATCGAAAAGC AAAAGACTTG CGACCATCGA TCAGCAAATA ATCGATGGTC GGTCATCTCC      1620
     TTCGAAACGA GCCAAATTCA CCGCAGAACC GCTTTGGCGA TCGTTACTCC GCTGCATGGA      1680
     CGCCCGGCTC TGGAACCATT GCTGATTTTG CAGATATCCG ATGCTTCGGC CAAGTGGCGA      1740
     CGACATCCAG AATCTGATCG ACGGTGATGG TGGTCATGCA ACGGGCGGCA TGGGGACAAT      1800
     TGCCTTGCAG GGGGGTGAAC CAGCAAGGCC GACAATCAAA TTCCTCGCGG CTCTGCACGA      1860
     TGCGCGAAAG TGCATTATAG GGATGCGTTT CCAACGGATT GGTCGGGCCG ATTGGAGTAA      1920
     TGGTCGGCAC GTTATAGGCG GATGCCGCAA TGTGGCCGAG CGCGGAATCG CTGCCGAGAA      1980
     AGCCCCAGGA CCGGGACAGG ACAAACTTGG TTTCATCGAG ACTAGCGCCC GAGATCAGGC      2040
     TGATCCCCGG TTCTGGCGGC GTGAAAGAGG GGATCAGATC CTGATCGTCC GGGCCGAAAA      2100
     GGATCACGAA GCGCAAGTCT GGATCGTATT TGCGCAGGCC CGCAATGACG TCTTTGACAA      2160
     GCCGCACCGG GACGCGCTTC TCAATGCCTG GTCCACGGCT GCTGCCAGGA TGGATCGTGA      2220
     AGAAGCGGGC ATTGGTCAGG CCCTGAGCCT CCAAGGTCGC CATGGCCAAT CGCCGCGGTT      2280
     CTTCGGCGAT GGGTAAGGGA AAATCCGGCT CTTCGACCTT ATGTCCTGTC CAGAGCGATA      2340
     GAGTTTGGAG CATCCGGTCG ACGCGATGGA CAGCCGGATC GATAGTGTTG CGATGTGTGT      2400
     AGAGCCAGCC GAGGCGGTTC CCGTCACCGA TGATCGTCGA AACCCCAGTC ACGAGGCGCA      2460
     GCAAAAGGGG AACCAGTGGC GTGATCCGCG TGCCGATATA GACCGCCTCG AAATGATATT      2520
     GCCGCAAGGA CCAAAAGAAC CGCAGCAAGT CCAGTTTCTC GCTATTGGGC GGTACTTCGA      2580
     GGATCTTGTC GATAAGGGGC GATTTGGCCA GCAAGGCGGC CTGCGCCTTG CCGCGCACGA      2640
     TCAGCACGAT CTGGGCGGCG GGGTGAAGCC GCCGCAGCTC TGACAAAACG GGCACCGTCA      2700
     TCAAAAGATC GCCGAGGCCC CAATGTTGAA AGATACCAAT GCTCTTCATG ACAAGATATC      2760
     CTCCGCTCCC TTCACAGCGC CCCGGCGGGG AAAAAGAGTC TGTATATAGG CAGGGGTGAA      2820
     GTTTGCTCCG ACCCAGACGC CATGTTTGCG CCAGACGAAC CAAAGCATGA ATCCATACAT      2880
     GCCGACGAAG GTGCCAGCCT GGATTACGGC CGTGACGATG ACATCGAAAC CGCCGAATAT      2940
     CCAAACCAAT AGAGCCTCGC TCATCGTCGC GCAAATCAAG ATGGCGAGCA CAATATTGGC      3000
     CCGGCTGGTC ATTTTGAGGA TCTCATCGAC CGGGCCCCCG ACACACTCCC CTAATGTGCC      3060
     GAAAAGCAGA ATGGCAAGAA GGAGGGCCGA GGCACGATAG CTCTCGCCAA AGATCAGGCC      3120
     GATGGCAAAT GGCCCGAGCA GAAGCGTGCC GGCGAGCGCC ACGAAACTAA CGAGGGTGGC      3180
     AAGCGTCGCG ACTTTGGAAC TCTCGATGGC GATCTCCTGC CAATCGTTAC GGGCAGCATG      3240
     ACGCACGATG ACCGGACGAA TAGTGAAACG AATAGCCGCC ATGACAGCGG CAATGGCGAC      3300
     ATTGAGCCGT GAGGCGGTGC CCAGAGTGGC AGCGGCGGCG GCACCATGAA AGGCGCCGAT      3360
     GCCCCAGACT GGAATCCAGT GGATCGAGCT TTGAAGGACG CGCGAAAGGC CAATCGAAAA      3420
     TCCGAGCCGC ATCGCGGGTC GCAGCGATAC AGGCTCGGAG GAGGAAGGAA AGGTAGAATA      3480
     ATAGAAGCCT GCGGTCGCGA GGGCCGCCAC GCTGCATAAA AGGCCCCCGA TGATCGTCGC      3540
     GACAAGTGTG GCCTGGATAT CAGGCGTCGT CGCAAGCGCA AGATAAGGCA CGGAGGTCCC      3600
     GAACAAGGCG ATGTTCATCG CGGGATAGAA GAAAAATGCT CCCTTGCCGC TTTCGCCGAG      3660
     GGCGACGAGC ACTTGAGCGG CAAAGAATGT CGCGCCGTAG CAGAGCCACC AAATAGCCGC      3720
     GAGGATGATC AGGCTACGGT CTTCGCCATA GCCCCCGTTG AAGAGCTCTG CAGCCGTCAC      3780
     GCCGAGAATG AGCATGACCA GGGAAGTGCT CCCCGTGGCA AGCGCGGCGC GTCGAACCAA      3840
     TGGCCGGATC TCATGTCGAC GGTCGAGGGC GTCGGCATGC GCGACCGATT TCACAATTCC      3900
     ATCGGGAATA CCAAAGCCGA CAAAGACATA GGTCGCGTTG ATGATGCCGA AAAGTTGCAA      3960
     ATAAATGCCA GCATCGCCCT GAGACAGTCT GCGTGTGATA AAAACCATGA CCACGAATTG      4020
     CAGAACCAGG GAAGCATATC TGAATATAAT GGGATACAGA TAGCGCACGG TATCTTCTTT      4080
     CGTCGTCACA CAACCAGATA TCGCCAGGCT GTCCGTAGAG GCCCGAACAT CAAACCAAAA      4140
     ATGAATGTCA TTTTTGGGTA TATTTGAGTT GTTTTCAGGA ATCTAGAGCA TCAGACAGGA      4200
     GTTCCGAAGT CTGATGCTCT CGCTCTCAAT TATCGATGCT TTCGTAAAAC GCGTTTTCCA      4260
     ATTTCAGGAA ATGCGCTTTC CATGTCCAAT CGTTAAGAAT GCATTCACGC GCGGCGTGGC      4320
     CGAGTTTTTC CGCTAAGACA CGATCGGACA GAAGCCGGAT GACCGCATTG GCGAAATCCG      4380
     TCGGTGAATC GGCGATGAGC AATGTCCCAG GCGGTGCTGA GACACCTTCA TTCGCCACGG      4440
     AGGTCGCGAC GATCGCCTTG CCGCTCGCCA TGAACTCGAT GAGCTTGTTT TGCATACCAC      4500
     CTCCCGCCTG CATCGGGTTA ATGCAGACAG CGGCTTCGGA GATCAAAAGG GCGGGATCGG      4560
     GCACAGTGCC AGTCACTGTG ACACCAGGCA ATTTGCCCAG CTCACGCACC TCAGCACTGG      4620
     GTTCCCGGCC GACAATCGCC CAAGTCGCGT TCGGTCGTTC CTGAAGCACG GCGGGCCATG      4680
     CATTTTTGGC GAACCATTGG ACAGCCTGAA CATTGGTCGG AGTACGCATC ACACCAGAGA      4740
     AGACCAGATG ATCAGGTTTC ACCTGAATGT CTTTTCGCGG CGTAAACCTG GTCACATCCG      4800
     TGCCATGCGC GCCAAAGACG AAATTGTCGA TCTCTGGTTG TTTGTTCTTG CGGCACGCAG      4860
     TCCTGATTTC CTCAACGTCA CTTTTGCCGA TGAGGACCGA TTTCGTGAAA TGCCTCCAAA      4920
     CGTGCGATTC ATAGCGCTCG ACGAGCCGGC TCTCGAATTC ATAGAAGAGC TTTAGCGGAA      4980
     TATTCGGCGC CTGCTTTGCA ATGCGCTTTG TATTCAGGGT CTGCGACAAT TGTAGGGCAA      5040
     GAAAACTGGC CGGCCGGCCG GCCCTCTGAT ATTTTGGCGT TCCCGCGGGA AAACCCAGTC      5100
     CCTTCGTCAC TTCCGCGCTG CGGAAGTAAT ATGTATAAAC GATGTCATAT TCGTTGTTAT      5160
     TGATGTGTTC ACGAACCTCG CGGATCTGCT GAGGATGCGA AAACAACCCG ACCTGCACGG      5220
     GGACACGCTC AGTCAGGACA CGCGTCAAAC CGCGAAGAAC CGACCATCTG CCGAACTTAT      5280
     AGGCCTGGCA CAATTCCGTA TGCTGTCTGA GCCACTCACG ATCTGCTTCG GTGGCCTGGC      5340
     CACCGGTATC GAGATAAAAG AGGCTGACTG CATGGCCGCG CGCATGCAGG AAAGCGATGA      5400
     GATGGGCGAC GGTTAACTGG TCTGCGCGCC GCATTGGCAA GGGAGTGCGG CCATAAATGA      5460
     TGCAGATCCT CAACTTGCGT TCAGCAGGCT CTACATCGGG TTCAGTCGGA AATAAAATGT      5520
     CGTGGCTCGA CACCTTAACT CTCTCCCTGG CTGCATTAGG TTACTGGGAA GTAAGACGTC      5580
     TATCAGTTAA GGCCGCCCCC ACCACCCCAT CGTCAACTGG AAGTGGCTCT CGTTATTCGG      5640
     CCTGAAATAT CACGCTTCTC ACGCGAGATC CACTATATGC CTGCATATCT ATATAGTGGC      5700
     CTCGCAGATA TTACCAGCAT AACCTCTTAC TACATTGCCA TGATGGTTTC CCCGCATGGC      5760
     TGGCATGCAT TCCGTTCCTC ACATCCTGTT ATAGAGACAA GTCTTCCACA GCCAGCGGCC      5820
     ATAGTGCCAT CGATGCCAAG AGCGACCATA CCGACGACGT TCATGGCTGG GACCGTCGGA      5880
     ACGCATTCGA ATTTTTACTA AAACATCGCT CGTTAATTCG GCCTCAAGAA CGATGGTCTG      5940
     GATTGTTGGA ACGTGTCAAT TAATTCAAAA GAGTCACCAC CTTTGAATTG ATGCTCTATC      6000
     GTCTTGGCAT CACTCCGATC AATGGGTCCG GCAGGCGATC TTGCTTCGGC GTCAAAAGAG      6060
     CGTCGATGGA GCCCTTGGCG CCTATGTACG AACGTCAGGT AAAGAAAATG CGTCACTTTA      6120
     ACAAGCTAAT GCATGATGCG GACAATCATG ACCGGAATAG TCTCGAATTT TTGCGCGCCG      6180
     TGCGGATCGA GAACTCATTG ATGACCTAAA GCTGTTTTCG TGCCAGATCA AGTTCAAAGT      6240
     TACGTGAAGG CATGGAGAGA TTGTGTGTTA TGGACAACGC GACGATCCAA TACATCACGC      6300
     CCAAAGGTTC TTTGACAATC TTTTGGCGAG ATAATCGGGG AGAAGGTCTT CAATCTATGA      6360
     AGCCACGTAA ATTGTTCTCC TGAAATTAAA ATATGCTAAA TAGGCCTTGC TTCTTGATGC      6420
     CTCGGGGAAA TTGTGAATGA CCGTTGCCAG ACGCCGCACA TTGACCAATA TACAAATTCT      6480
     GCGCGGCTTC GCAGCCGCCA GCGTCGCTCT TGCTCATGCC GCAAACCAGT TTCCTGAGGT      6540
     CGGATCAATA CCTCGTATCG ACGCTGCCCA GGCTGGTGTT GATGTATTTT TCGTCATCAG      6600
     TGGCTTTATT ATGGTCTATG TGACCTCAAC GCGTCCACAA ACCAGCAGCC AATTCCTTTT      6660
     GAACCGCGCC AGCCGCATCG TCCCAAATTA TTGGTTCTAC ACTTTGGCGA CGGCGGCACT      6720
     CGCGATTGCG GCCCCTGCGG TCTTTCGCGG CACGAGCTTC AATCTCCCCC ATCTCATTCT      6780
     TTCCCTTTTC TTCGTCGCGC ATCCCAATCC GGCATTGGAC GATTCAGTGT CCCCACTACT      6840
     GCGCGTCGGT TGGACACTGA ATTATGAGAT GTTTTTTTAT CTGATCTTCG CCATCGGCTT      6900
     GCTGCGGCCG CAATCGAAGG TGACGACCTC CGTCGGGATC ATCATTTCCC TTGTCTTCCT      6960
     TGGCTTTCTT CTGCCGGATC CCGGCCCTGT CACACGATTC TATACGCGCG ACATCATGCT      7020
     CGAATTTGTT TTCGGAATGC TTCTCGCGAT CGCCTATCTG CGAGGGCTGC CCAAGCTCCC      7080
     TGTGTCCCTC ATTCTCGCGG CCTGTGCCGG AGCCGTCTTC TTCATGATCC TGTCGGATGA      7140
     TGTTGCGGAG AACACGCATG CCGTGCGCAG CATCTTCTTT GGTCTCCCTG CCCTCGTGAT      7200
     CGTGGCTTGC GCCCTGATGC TTCCCGATCA TGACGACGGC TTTGGCCATG TGATCCTGAC      7260
     CCGTATCGGC GATGCGTCCT ATACGATCTA TCTCTGCCAT CCTTTCATAC TGACCCTTTG      7320
     CCGTGTCGTT GCCGTTCGTC TCGGCCTGCA GCCCATGAGC CTGTTAGGAA ACATAACTTT      7380
     CATGCTTGGC GCCACGGCGG CGGCCACTGG CATCGGCTAT CTTGCCTATC TGTTCATCGA      7440
     GGTGCCGATT GGTCGGTCGA CGAAACGTCT TTTTATCCAA CCACGCCTTC GCGCGGTGGA      7500
     TCCGTAATGC GGATGGAGGT GGAGGCGATC ACTTTGGGAA ATCTCGCATG TTTGCTTTTT      7560
     TCAGCACAAG CAAACATGCG AATTGTGTCC CATCAGCCAT TCTCTACAAC TGATGGTCTT      7620
     ATACCAAGGG GCGCGGATCG CGCCTTCGCG TTCCAGAATG TTCTTCTTTA AATTCCTTCG      7680
     GGCGAAGAAC ATTCTGACAA CTGCTAAAAA GCCCTGATCG TTCTATCAAT CGAGATCAGA      7740
     AGCGATGATT ATAGATCTTT GGAAACACAT AAATTCAAAC CAAAAGCTGC CCCACTTTTG      7800
     GTTTGAATTT CCTGTTCCCC TACCGTCACG TCTCACGGGC AATGAGACTT GGTAACGGAG      7860
     CTGATTTGGG ACTGGAGCAT CAGACACTCA AGGTGATGTC TGATGCTCCA GATTTTTGAA      7920
     GGGGCATTAG GCATTAGATT AATCCCGAGA GCGCGATCAA CTTTCAGGTC TGTTACTTCT      7980
     GCCCCTGTCA GATCCTTCTA TCGAACCCAC CTGCGCAACC CGCCTGGGTA GATCGAACCT      8040
     CTACGCCTTC TGGAAGCACT TTCCTCTTCC AGATCGCCAC CGTAATAACT TTCCGTATAT      8100
     TGCATGCCAC TGAAAGACCT CATCATTTTG AGGTCGACTT TATTGAGCAC GACGCCAATG      8160
     CATTTCCGCA TGACGGTATA ATTCTTCGTC AATGCGGCCT TGGCCTGCAC TTTCGTCGTT      8220
     TTTCCCCATT CTACAACCAT CACGAAGGCG TCGAACATTT CCGCAGCCGC GCGGACGTCA      8280
     ACGACAGGGT CCAGAGGCGG CAAGTCGACG ATGATATATT CGTACCCCTC TCTTCCGAGA      8340
     TATTCCAGGA CGGTGCCCAT GGCTTCCGAT GCGAGCAAGT GGCTCGGATG CGCCAACTGC      8400
     TGTCCCGCCG GACCGGGGAG GAAAACAAGA CCGGAATCGT TCTCGACAAG CATGACCTCT      8460
     TTCAACGACG ACACGCCTCG CAAAAGTTGC GTTAAACCGA CTTGAGCGGT CGGACTCAAG      8520
     GCTAGAGTCA GCCGGGAACG ATGCAGGTCG CCATCGATCA AGATGGTTTT GATGCCATGA      8580
     CTGGCAATCA GCGTCGCGAG GTTTTTGGAG ACGATGGTCT TACCCTCGCC AGAGACCGAG      8640
     GATATGACGC CAATGATTTT GGGGCGCTTG CCAGTCAAGG AAATATCGAC TGCAACTTTA      8700
     ACCGCTCGCA TCGTCTCGGA AGCCATCGAG AAGGATTGAT CGAGGGTAAA TTTCATCCGC      8760
     GTAGGCAATG CGCCGAGTTC GCCCGCTCTT CCAGGTTGGG CCGGCGCGGC AACTTTCTCA      8820
     GCTGGCAAGA TGGGCAATAC ACCCAGCACA TCGAGACCGA GTTCGGATGT AACCTGCGCT      8880
     TCGGTCCAGA ATCTCCGATC GAGGGCATCC CGTGCCAAGG CCGTTCCACA ACCGAGAAAA      8940
     AGCCCGCCGA TCAGACCGAG TCCCAGGACG AGAAACGGAC TCCTCGCCAC GGCGATCGGC      9000
     TTGGCCGCGT CTCCGATGAT GCGCGCCGTG CTGCCCGGGA AGGATTCCTG CTGCATTGTT      9060
     TGCTGATAGC GTTCCAGATT GACACGATAC AATTCTTTAA GAGTATCGGC CTCGCTCGTC      9120
     AGCTCACGCA AGTGCACCAT GACCTCGTTA TTTGCCGAAG CCTGAAGCAT CAATTCGTTG      9180
     ACGTTCTTGT TGATCGCGTC GAGATGGTCC TTCGCGATCT CATAATCGCT CTTGTAGGTT      9240
     TCACCGATAT GGCGCAGTTC CTCGAACAGA AGAGCTTCAT AGTTTTTGAT CTCCGCGCGC      9300
     GCATTTTGCG CGGAGGCATG GTTCGCGCCC CATTTCTGTG AAATATATTG CTCTCTTTGC      9360
     GAAGCATCTG CGAGCTTCAA CCGCAAAGCG TCGATGACTT TGCTGGAAAG CGACTCCGTC      9420
     ACGGCTGATC TGACGTCACC GGAGGCGAGA ATGGCATCAA TTCTGGTTTT CTTGGACTCG      9480
     GCGTCGGCCA CCTTCTGACG GGCATCGGCA AGCTGGGCAC TCGCCTTCGA AAGCTGATCC      9540
     TCGTTGACCA GCATCCCGTT GATGGTTTGC AGATTATGGT CCGCGCGGAA CTTCTGGACT      9600
     TCGAGATCGG CCGCATTCGC CTTCACTCTC AGCTCCGCGA TATGGGCTTG CAGCCAGGTT      9660
     CCGGCCGTTT CCGCCGCGGC ATATTTGGCC TTCAGCTGAT CCTTGAGATA TTGTTCGGCG      9720
     AATGTATTCG CTATTTTCGC GGCAAGCACC GGGTCCCGCC AAGTGAACTT GACTTCAATG      9780
     ACGAAGGTCC TGCCCAGCCT TTGTACGGAT ACATTATTGA TAAGAGTCTG AACGATTTGG      9840
     CGTCTCAATT CATATTCGGC ATCTTTTGGA TCTGATTTCA TGCCGAATAA ATGTCCGATC      9900
     CCCCGCGCGG TGGATTTCAC AAAGCCCACG ACCGGGGTAA TAACGGGAAT CCATGTGGGG      9960
     AGGAATGACG GCTCTTTCTC GAGATTGAGC GCATCGATGA CGGCCAAGAC CACGCGTTCA     10020
     GATTTGAGGA TTTGAACCTG ACTGTCCGTA TAGCCCGTAT CGGCGCCGGA CGCTGAACGC     10080
     GTCACATCAT AAGCATCGGA TACCGCTGAG ACACGCGGGG CATCCGTGAG AATGTCCGTG     10140
     GTCGCCGTAT AGATGGGTGG TGCCACGAGC TGATAGAGAG CGGCAACGAC AAGCCCCGCG     10200
     ACGACCCAAC CGCAGATCCA TTTCCATTGG CGTTCTATAA TGGCCTTGAT ATGCGCGAAA     10260
     TTCCAATTTT CCCGAGCGGA TTCCCCGGAT ATATCGGTTT GTTCCCGCAG ACGGTATGTC     10320
     TCAACAGATT TCAACATTGT GTTGGGATCC ATGCCTTATT TTAGCCACTG CCTGAAATTG     10380
     TCTATGGCTA TACATCATGC TTGATTAAGA TCGAACCCCA AGAATTATTC ATTTAATAAA     10440
     CCTCATTCAG GCTGGGTATT TTTACCTGGC GCAAGGAAAA CCTATCTTTA CTAAGATATT     10500
     GAAAGTTACC GCTCAGCTTG TCAAGATTGC CCCCGTCTGG CCATGTAAGG GATAAATTGA     10560
     AAGCGTCTTG CCCTGAGAGA CTTATTTATC GCAGCCCCAG ATGATCGTTT TATGGCGCCA     10620
     AGACGCCTTG ATCATGGAAA GGGAGATTTC CGCAAGGATC TGGTGCTCTT TGTCGTAGAA     10680
     TTTCCATCAA GACATCGCAA AACCCACCCC GTCTGGCAAG GTTGGTTCAC ATTATCCTGC     10740
     AATGCGTCGT ATATTTCCTT ATCGAAACAA AAGAGCTCTG GCCACCATCC GGCCATCATG     10800
     ATACACGGCT CCATCTCTCC ACCATCACTA CCATCTGGTG ACAGCTCTGG TTGCATTGCT     10860
     TGAAACCTTT ACCGCTCCAT TCTATAGTCT CCCCGGAGAG ATCAAATGAA GCTGAATAGT     10920
     GGAAACAGTT TTTCCCTCGC GACCATTGAA GACAATCGCC GATATTACGA TGGGTTTTAT     10980
     CCTGGCTTTC TGCTTCTGAG GCATGCGCTG GCCTTTCTCA TTATCGCAGT CCACACACGC     11040
     GGACTCGTTA TGGGCGTCAA ACATGCCAAC CAGTTTGTCG GACAGACGGC CCCTGGCGTC     11100
     AGCAGCTTTT CCGATTTTAT CGCAACCCTT TTTTCCTCCG CCGCCTTCCG GCCGCTTGGG     11160
     TTCGCTTTGG TCGGCGCCTT TTTCGCGGTC AGCGGCTTCC TCGTATCGGG AAGTGCCATC     11220
     CGCACGGGCA GTATTCGCAC ATTCCTCGCC TTTCGCGGCC TCAGGATTTT CCCCGCGCTG     11280
     GTTTCCGAAG TGACGCTCTG CGCCTTGCTC CTCGGCCCTC TGACGACCAC AGTTCCGCTG     11340
     TCCGATTATT TCTCTGACCC TCAGTTCAGA GTCTATTTCC TGAACATACT CGGAATAGCG     11400
     CATTATACCC TGCCGGGCGT CTTCGAGAAT AATCCCATGC CGCGCATCAT CAACGGCAAT     11460
     CTGTGGACAC TCGCCCCTGA ATTTTATTGT TATCTGATCA TGGCCGTCGT GATGATGTTC     11520
     GGCATTCAAA ACAAGAAGCG GCTGTTCGGT CTGATCATCG TCGTCCTCAC GCTGGGCATA     11580
     TTCGCAAACG AGCTAACTGG CTTTCTCGAT CTCCCCACGC GCGCGCCATT GGTCTCACGC     11640
     TTCAGCGTCT GGTTCGTCGT CTATATGTTC TTCGTCGGCG TCGTCTTCTA TCTCTTTTCA     11700
     CACAAGATCA TCCTCAATTT CTATCTGTTC CTGGCCTGTG TCCTCGGCTA TTTCAGTCTG     11760
     ATGATCATCG GGGGCTTTGA CACCATTTCC GCCTGGCTGC TTGGTTATTG CGCGATCTAT     11820
     GTCGGCATGA TCGATACAAG GTGGTTCGAT AGGCTGATCC GGAATTCCGA TTATTCCTAC     11880
     GGACTCTATC TGTATGGTCT GCCCATTGGG CAATTGATGG CGCTTTTGCT CGTCGTCAAA     11940
     TTCGGCGTTC CGCAAAACAA CGGCACGATT ATCCTGCTTC TCACCCTCAC GATCGTCTTT     12000
     ACGATTGCTT TCTCGGCCGT ATCCTGGACA TTTGTCGAGC GTCCCGCACT CAAGTTTAAA     12060
     CGCATTCTGG CGGCTAAACG GCCAGTCGAA CGCCAACGTG AGGATATTGC GATAGAGGCC     12120
     AGCAGCAGCT GAAGGCCCTT GAATAGCTTG CGATGATCGT GGAGTTTTGA CTCTTTCGCT     12180
     GAGCAGCCCT GCCCGGCCAA AGCCGGGATT GGCAGACTTT TTTTAAGCAA AATCAATGCT     12240
     GCTCAGCGTT CAAGCCGAAG CCAACGGAGA GGCAATAGGA GGCTTGAATA TTTTGCTGTC     12300
     GAGCTGTCCT GAGCTCTTGT CAGAAGCTGT TTACGACCTT CGTTCCGATG CGAGGTGTGT     12360
     TTAAAAAAGT TTATAATTCA GTGCCAGATT TCCTTGCGGC ACGCCCTGCC ATGATGCCTT     12420
     TCTATCTTCT GCGGTCCGAT CCCAGGACCG ATAGACTCCT CCAGTTCTTG TCCTCGAACG     12480
     TTTGCTCTTT ACCGGAAAAC ACGAACATTC GAGGCTGTTC GAATGGCCAT GAAAATCGAC     12540
     TATTCGAATT CTAGCGGAAA AACCTCGGGG ACCGACTGAT CCTGACATTT GCGGATGTCA     12600
     ATGTCCGGGT CGGACCACTA GGAGATTTTG GGCTCCCTCC GGCATGTCAT GTCCTCGAGG     12660
     CTGCCTCGTG CCCGATGCCG TTCCCACGTG CCTCGGGTTG ATCCTTAATC AACGAACAGG     12720
     TTCGGTATGG TGAAGAGCAA ACTTCTCAAG TTGCGCCGTA CTCTCGTGGC TCTCCACTAT     12780
     GTTCCCTTGC GCAGGATTTT ATTGCGCGGC CGTCGGGAAA TGCGTTGGCG ACGCTTGTTG     12840
     AAATCGCCCA AAGTGGCCTC CGCTCCAGCC CTTTCTGCAG CGCAGCGCAC CCAAATCATC     12900
     ACGCTTCTCA CGACGCCCGC CTTCACGAAG GCGGCACGGA AGATCGCCGA GCTCACGGCC     12960
     AGTTCCTTCC TTTACGAAGC TGATACCGAT ACGCTCATCT TCATTGCGTC AGGCGATCGC     13020
     GTTCGCATCG ACGACATTGA TGATGTCGCC TGGACAAAAA AGGGCGGCAT TCCGGCCAGC     13080
     GACGTCAATC GCAGTTTCTT TATGAGCTTC GTCGAGCAAG CGACCTTGGT GAAGGGTGAT     13140
     CCGCGCACCG ATCTCGAACA GATCGATCGC TATGTCGCCC GCCTGGTCAA AGCAGCCCCG     13200
     ATCGCCGGCA CTTTCCTTCC CATCCCATGG CATTCATTGA CCGTTGCTCG ACGCGCCATC     13260
     AATCTCCTGG CGGCCTTGTC CTTGTTGCTG GAGCGCGATC CATCCCTGGC CTCTCATATG     13320
     GCCGTCACTT CTCTCATCGA GCACATTGCG CTTCTCGAGC AACTCATCGC CTACCTGCGT     13380
     GAGGATGATC TCGGCTATAA TCATCTCGCC AGTGAGGTTT TTGCCCAATG CCTCATCGCC     13440
     TATGCCTTCG GCACGGATCA GCGGTTCGAA CGTCTGATCG CAGAATTCCT GGATGTCATC     13500
     GACGCTCAAA TCAGCGCCGA CGGAATGCAG TTGGAGCGCA GTCCCACTTA TCAGGCGCAT     13560
     GTGCTCGGTC ACGTCGACGT GCTCCTTGCC GGCAATATCC TGCCCGAGGC CTTCGCGCCG     13620
     CGCATGCGTG ACATCGCCTC GCGCATGCGC GAGGCACTGG CCATTTTGAC ACATCCCGAT     13680
     GGTGGTATTG CGGTGTTTAA TGATGCTGCG GTCGGGGATG GTCCCACACC CGCAGCACTC     13740
     GGGGCCTGGC CGCGCGTTTG GAGCGAAGGC GTCGTGGCTC TTCCCGATGC CGGCTATGCG     13800
     CGGCTAAGAG GTGGAGATCT CGTAGCGATC TTCGATGCCG GCCCCTGTGG TCCGGATGAT     13860
     AATCCTGGCC ATGCCCATGC CGATTTTCTA TCCTTCGAGC TCTCCTTGGG CGACAAGCGT     13920
     CTGTTCGTCG ACCCGGGAGT TGCCTCCTAC AAGGCGAGTC CAGAACGAGA TCGATGCCGG     13980
     TCGGCTGCAT CGCATAATGG TCCAACCTTC TTGGGCCTCG AGCCGATCGA GTTTATCGGC     14040
     CCATTTCGCG TGAGCCGACG CGGACGCGCC GAATTCTTCA CCGAAGCGTC GCTTCCAAAG     14100
     ATCGGGGCAC CTGTCATGGC CGCGGGCTGG CAGAACGGGT TTGATCCTTT TGGCGGACGT     14160
     GTCTCGCGGT GGCTTGGCCT CTGGCCTGAC AGCATCCTGA CAAGCGTCGA TCTGTGGACG     14220
     GGGCGTGGTG ACCTCGAAGC CGTCTCCACC TTTCTCGTAC CCACCATCTG GCACATTCAG     14280
     GAGAAAGATT CAAAACGGAT CGTGTTCGGC TGTGAGGAAA CCGGGGAACG CGTTATTCTT     14340
     CGGGCTCTTA AGGGAACGCT GGCGATTGGA CACACCATTA AATATTTCCC GACCGGACCT     14400
     CGTTGTCCCG AGCCCGCCCA GGAAGTCGTT CTGCATCCCG ATGGTCCGAC CTCCGATAAA     14460
     CGCGTCGCAG CTCTGATGAT CGCCAAGACA GATGCGGCCA TGGACATTGG CCTAGACGCT     14520
     TCAGCATTGG ATCGGGTCAT CTCCACGCTT GAAGCCACTC AGCCGAAACG ACACGGATGA     14580
     GGTTTTCACT CTTTGAAACG CATCCGCCCC AAAAGTGGAT ATCACTTTGG GGCGGATGCT     14640
     ATTTGCTTAT CGAATTGACG CTTTTCTCTT CACGCCAAAA GGCTCAATCT ACGCCAAAGC     14700
     GTTGATATCG ATAAATTTGT CATAGGTGAG CTTCAACGTC TTGGCGCTGC CATTAGTGTC     14760
     GATCACAACC GCGAAACGGT CTTGTTCGAT CTGCGACTGC GAGACGAGCA GCTTCTCGAG     14820
     ATTGGGAAGC TGAGAATAAA CATAGCCGAG ATTTTGCCCG ATGAGATCAC GCGGCTTGAG     14880
     AGCAGGATCA TAGATCGACA GTCTATAGCC ACTCACCAGG ATCTTCCGAG CGAGATCGAC     14940
     TTTCGGGCTC TCTCTTAGAT CATCGCTATC GTATTTGAAC GCCAGGCCCA GCATCAGGAT     15000
     ATGCGCATCC TTGGGGACAC CTTTCAAACA ATACTCGAAG AGATAATGTT TGTGAGCCTC     15060
     ATTCGAACGT AAAAGCGAGT CAATAAGATG CGTATGCGCT CCCGCATCAC TGGAAATATA     15120
     TTGAAGCGCG CGCACGTCCT TCGGCAAGCA TGATCCGCCG AAGGGGCCAC CGGGCCGCAG     15180
     ATAATAGGGT GAAATATTCA GTTTCGTATC CGAGACGAAT ATTTCATGCA CTTTCTGCGC     15240
     GCTAATGCCG AGCTGGAGAC AGACACGCCC GATCTCATTA GCAAAGGAAA CCTTGACGGC     15300
     GTGGAACGTA TTATCAACGA ATTTCGTAAA TTCCGCTTCG CGGTAACGCG TATAGAAGAC     15360
     CGGAGCTTTG AGGTTCTGGT TCATCTTGTC CATATTGGCG CATGGCTTGC CGTCAAATGT     15420
     GCCAATAACG ATTTTGGGCG GATTGAAGAA GTCGTTGATG GCGACAGCTT CACGCAAGAA     15480
     TTCAGGATTA TAGACGAGCT CGACGGCATT GATCTTGGAG TCGAGCACAG ACCTGAAGAT     15540
     TGGCAGAATG AGCTCTTCGA TCGTTCCGGG GCGAATAGTG CTTCTGAAGA CGACGGTGAG     15600
     AGGGTCTTTC CGGTCTGGAT CGACGGCGTG GGCGATCTGG CGCGAGACTT CCGCGATATA     15660
     GCTCATATTA TGAGCGCCGT CGGGCCCGCT GGGCGTGCCC ACGCAGACGA TCGCCATGTC     15720
     GCATTCATTG ATGAGATTAC CAGGATTGCT GGTGCACTTG ATGAGATTAT TTGTGACAGC     15780
     TTGCTGCAAT AGCTCCGCGA GACCGGGTTC CTTTATGGGC GATGTGCCTT CGGCGATCTG     15840
     GCGGATTTTG TCTTCACTCA CGTCGACGCC AAGGACCCAG TGCCCTTCCT TGGTGAGGCA     15900
     TCCCGCCGCC GTGAGCCCTA CATAACCAAG TCCATAAATC GCTATTTTCA TTGCCTGTCA     15960
     CGATCCGCTA GAAATACTAT TATGGTAAAA CGCACCATAT ACAAACTAAA TCAGCATTCA     16020
     AGCGCTTATT TATAAGTTGT TCCAAAGAGT CTGGCAGGCC AATTTAGACA AGTAAAATAT     16080
     ATAGTATTTC AGTGCAAATC ATTGATGACA ATCATAATAA AGCCAAAAAG CCTCAGGTAG     16140
     CCACTTAGTA GCTATTTAAT GGAATTGTCA CATCCCACTG AGGAACATGC CGGTCCTTTC     16200
     ACCTTCAGCT GGAATTACGA ATAGTGTTCG CTAGGGAAGC ATAGCTGTGA GTAGCCCTCG     16260
     TAGAAGCCGA ATGCGCGCCT CCAAGCGCAA ACCGCCTCTT TGCCGATCTG TTCCAGATAT     16320
     CTATTTCGTC CAAATCTTCG TAGGGTTATC ACGCAACTTG CGGCCAAACT TTGTAACACA     16380
     ACTCAAAAAA TAGCGTTTGG ACACAGCCTC TGTGGATGCC AATCACTTCA TCTCTGCTTG     16440
     CGAAAAGGAT TCTCTGAGGC GCAACGAGGT GTCGATTTCT TGCTTATCGG CAAAGGGCTC     16500
     GCCAGCGTGA TGGCCTCCGC CCCTTGCTGT TCGAGAGCGC TGACGGCTCG ATCTGATTTT     16560
     GTCGGCTAAA GAACTCCTTC CCCTTTCACA GGGCATCGCT TTCCAAGCAA TTCTTACTCG     16620
     GAACCGGCAA ATGCAGGGGA CCTTTACGTT CATCCAGAGG CCTTCTATCA GGACCACGCG     16680
     ATCGAACTGT CACTCAATAC TCCAGTCGTT ACGGCTCTTC CCGAGCAGCA GTTAGTGAGA     16740
     ACAGAGGGAG GCGAGGAAAT CCGGTACGAA CGGCTCCTGA TCGCAACGAA TGCCGGTCTA     16800
     AAGCTGCTCG CCCTTCCGGG GGCTGATCTC GAGGACATTC ACGACTTGCA ACGCAAGGCT     16860
     GAGTGCGATG CAGTCCGACG CCCAGCTTCC TTGGCATGGA GATCTCCATG CCACTCATCT     16920
     CTCTGGATCT CAGCGTCACG ATCATCGAAA TCGATAAGAG AGTGCTCTCG CACTTGGAAT     16980
     CGCAGACTGT CTCCGACTTT TTCAAACAGC ACGCCGAGTA GTAAGGAGCG TCTGTCCTGC     17040
     TCTGCGATAC AGCAAGCGCG TCTTCATCGT CGACCTGTTC GCCGAACAAA GGGCCCTGCC     17100
     CACGAACATA ATGGAGGTTG TGGGCCGCCG CGACGAGATC GTCTATTCCA AGCGTATTCG     17160
     CAGCGACCTG TGCTTTTGCG AGACGGTTGG CGCCTACCGC AAATTGATCA TCGGGATTCT     17220
     CACAGAGGTC GAGCCCACCT CTCTCACGAA GATCAAGCAC CCCCTCTCCA CATCGAACTT     17280
     ATGGGAGATG GCACGCCAAT GAACATCACC CGGTTTGTGC GTGTAGGCAC AAGTGGCGAA     17340
     CCATGACTTC TCGGAGAACG CAAGTTCACA AAAGCGAGGG CTATGATCTT GTGAAGAAGA     17400
     CGCTTGGCAG AGCCAAGAGG GAGTACTCTT GCAGGAAGCC CCTCTGCCAG ATCACCAAGA     17460
     CGACTTTAAC ACTTGCTGGC CAGCGCACTC ATTGCGCGAA GGCCAGCTAG CGCTTCTTCA     17520
     AGGCGCACGG CAAAAGTTGG ATGCATCCAA CTTTTACCGT TTATTCATTT TAACCATCTA     17580
     AGTTGGATGC ATCCAGGTTT ATGGTTCGCC TCGAATGCCC TGCGCATCGG CGTATGCTTG     17640
     GATAATATTT TCGAGTAGCA ATGAGCCAAA AGTGAACCTG ATTAAAGGTT GGTCGCGAAG     17700
     CGATTTGGTT TGAACGCATC ATGCTCTCAA GGAAGTCCGA CGAGGAATGA GAATGGCCGA     17760
     GATGGATCCT GTGGATACCT ATCGCCGCAT CGCGGATGTT TTGCGTTCAG CGCAACGCGT     17820
     TGCAATTGAA ATCGAGAATG AGCCAGAGAA GCGGAAGCGT CTGAGAACAT TTTCGCCCCA     17880
     GGAAGTGGCA ACCCTTTTGA GAGTAAAGCC GCGAGAGATA ACGGCTTATA TGAAATCAAC     17940
     CTCCGATCAG CTTGGTGGGG CACGCAATCG CCTTACCTTC AGCGATATTC TCCAGTTGCG     18000
     AAAATCCCTT CACGATTCAT CCGGCGACCT GCGGTTTTTC CCGAGACGTC AACCAGAGCG     18060
     CGGAGAGGGA CTGGCGACCG CTGTTTTCTC CAATTTCAAG GGGGGATCAG CAAAAACCAC     18120
     GAGCAGTGTC CATTTCGCCC AATATATGGC TCGAGAGGGT TATCGCGTCC TGCTCATCGA     18180
     TCTCGATAGT CAGGGTAGCG CCACGGCCCA GTTCGGCATC GATCCTTCCA CCGAAGTCGG     18240
     GTTTGAAAAT AGTTTCACGG CTTGGACGAC GGCTCGAGAG ACCGGGCAGG AAATCCAGGC     18300
     TTCATCGCTT TGCCAAGCCA CTTATTGGCC ATCCATTGAT CTGGTCCCGG CAGGTGCAGT     18360
     TCTCTCCCAA GCCGAGGAGT CGCTGTCGAG GAGAGCAGCG AATGGCAATG TCGAAGACGT     18420
     TTTCTATTTC GATGAATTGG CAAGCTTTCT GGCGGCTGTC GGCGATAATT ATGATATTGC     18480
     GGTCGTGGAT ACGCGGCCTG ACGTCAATAT GTTGATGACG ATTGCGCTGC ACGCCGCCAC     18540
     AGGCCTTGTC GTGCCGACAC GCGCAACCAT GACCGATCTT GCATCGACGG GGGAGTTTTT     18600
     CTCCCACCTC GCTAATTATA TCGCTGATTT CAAGGAAGCG TTCGGCAACG GCCTCAAGGT     18660
     CAAGTTCACC AAGGTTATGG TGACGGCCTA TGATCCAACT GACCGCAGCC AGGAAGCCTT     18720
     GGTCGGCCTC ATCCGCGAGC GTTTCGGAGA TGTTGTCCTG GAGAATGAAT TTCTCCATTC     18780
     CAAAATCATG GGGACGGCGG GGTTCGGTAA GGAAACACTC TACGAATATG AGCCGAGTAC     18840
     GGATCGAGCG GCCTATAACC GGGTCATGGC GAGTGTGAAT GCGGTCAATC ATGCGATTGA     18900
     GCGTGAGATC CTTCAGAGTT GGGGAAGAAT ACCTGGTGAG TGGTTCGATG ATATGGAGGC     18960
     GCGGGCATGA ACAGCGCTAA ATCCCGTTTC AGTAGCTTGG CTCAGGCCGT TAAAGAGCGC     19020
     ACGGTGGAAT CAACACCAAG TCCCCTTGAT AACAAGCAGA GCCGATTGGA CGGGGCGGGT     19080
     GTTCATAAAC CCGTGACGGC CCTGGGTGCT GTAGGGGAGG CTCTTCGTGA GCGTGTCGGC     19140
     CGCCTTGAAA CGGAACTCGC TGAGACAAGT ACGGCAAATG CGGGACTCGT CGCTGAACTC     19200
     CAGCGCGTTA AAGCCTTGAG TGAGCGTGTT GGTGATACAG CGGAGGAATT CCGCTTTCTT     19260
     GATGTAGACA CTATCGTCGA CCGCCTTCCA AAAGACCGGC TGCGCGGCGG CTGTCAAGGA     19320
     CCGGAATTCG AGGAACTACT CGCTGATATC GAAGCCAATG GACAGAACGA TGCCATCACT     19380
     GTGCGGCGTT CATTGGAGGG GACATTTGAA ATTGCAGCGG GCCGGCGCCG TCTGGAGGCA     19440
     TGCCGCCTTC TTAAGCGCTC TGTACTCGCG CGCGTAAGGG ATCTCAACGA CCAATCCATG     19500
     CTTGGCGTCC AATTTTCAGA AAATGAGAGA CGCGCGGATA TTTCGGCTCT CGAACGGGCG     19560
     CGCTGGTTTG CGGAGGTGCG AGAGCGGCTC CAAATACCAG CAAAAAATAT TGCGGCTCAG     19620
     TTTGGTGTCG ATCCCTCAAC TTTCAGTCTC TATCTCAGGC TGGCTCGGTT TCCAGGTGAG     19680
     ATTCTCGAAC GATTGCAAGA GCCACGGCGG CTTGCCGTCC TTCCCGCGCG CCGCGTTATG     19740
     GAGGCGATTG AAAGCGATTC AACAGCCCTT CAACGTATTC TTGGCGCCCT TGATACTTAT     19800
     CAACAAACCG TCAGCCGGGC TGAAACCGAG AGCGACCCCG CAGCCCAGAT CGACGTTCTG     19860
     CTTCAGGCGG CCGATAGCAG GGGCGGTGGC CGCGAGGGCT CTCGATCCCC TGTCCCGGAG     19920
     CGGCGGTCTA TCGTCCACCA AGGGCGGCGA ATTGGAACAC TCACGCGGAA TGGCGGGCAA     19980
     TGGGTCTTTC GATTTGCAAC CTCGATCCCT GACAGTGAAG TCCTTCTGCT TGCCGAGAGA     20040
     TTAGCGCTTC CTGTCAGTGA TCCTGATGGC GACTAAAGCA TTGGATCCAA AGCTGGCCTG     20100
     ATCAAAAATC AGCCGGCATG CTTGCAGGAG ATTCCTGTAT GCGTCATGAT CAGCGCATGC     20160
     ATTGTGATTT CCTCTGTTTT TCTTTCGCTG GACAAAGCGT GAAACCGCTA CTGACGGCAT     20220
     TGATCATTTG GTGTCGTGGC CTTTTCTTGC CTGCATGGGA GCTCATTTGA TGCCGATCCG     20280
     TGCACAGGAC AGGTGGTTTT ATCCAATCGA CTGGCCGCAA TTGTCGATTG TGATCCGGTT     20340
     CAAACGGGCT GGAGGACGAT GTGAGCAATG CGGCCGTCCA CATGGCCGAT TGGTCTGGTG     20400
     TCTTGATGAT GGCCGCTGGT GGGATGCAGA AAGCACGCTC TGGCGTGATA GCCGGGGCAG     20460
     GAGGTTGAGG CATCTGCCCC GCTCACAGGA TATTTTTGCC ACGATAAGAA GCACGAAGGT     20520
     CGTTCTGGCA ACAGCCCATC TAGATCATGA TCCGAGCAAT AATAGCACGG GCAATCTGAA     20580
     GGCACTCTGC CAGCGCTGCC ATCTCCTTTA TGATCGAAGG GAGCATCGCC GCCGGCGCTG     20640
     GCTGACCTTG CACAGGCGCA AGGCGCTCGG TGATCTATTC CTTGGCCCTT ATCTTACACG     20700
     CTGAGCATGG CGATCCCGGG CTATCTATTT GTTTTGCAGT GAGAAACTTG TAGCCTGTAG     20760
     TGAGACAACA CACTCGACTA TATTCTTCGA GGGTAGCTGG GGTTTAGCAT GCTCATTCCA     20820
     AGTCTGTTTA AACAGTTTTT GGAACGATAG GAGCTTCAAT GGCTCATCTT ATTTTGAAAT     20880
     TGCTTTTAGG CTAATGATTA AATGGAGTGA AATACGGATT ACTCATTCCT TTCTTTTTAA     20940
     AAAATTTTAA AAAATGAGCG CCAGCGTTTT CAAATTTGTT TTTATAGTTT TAAAACTAAA     21000
     GTTTTAGTTT CATAAAGCCC TATAAAATAA TGGGTTTTCC CTGTTTTTAG GACTAAAATA     21060
     CGTTTCTGAC AGATTGAAAT ACGGTACTGA CAGATTGATG TACGGCACGA GTGGTGTCGT     21120
     TGTACGGCTG ATTTTGTCTT ATCCACAGGC TCGGTTTTTG ACAAAAGCCG GCGGATCGAA     21180
     ATACGGGTTT TGTCAATTCT GGGTCTGTTT AAACATTGCC TTAGCGAATC GTTTTTGACA     21240
     AAGGAGATAG GACCAAAGTA CGGTTATTTT GGCAGGGGCT GGTTTTGGCA ATCCGGGAAG     21300
     GATCGTTGTA CGGAATTTTT GTCATATGCT CTATTGACCA TGCGAAGGAC GGGTTCAGTT     21360
     TCTCCATCGA TTAGGCTGAG GTCATAATCT GGCAGTGGGA CAGCAGCTTC GACGATCTCA     21420
     CGGATTGCCT GCCTGAATTT ATGGCGAGGC AGCTTTGATC CGCTGCGTTT GTGCAATTCG     21480
     GTTAATCCGT AGTGGGCTTC GGTCTGGCCT GCCGCTTTGC GGGCCAGACG GTAGAGAAAT     21540
     TTCGCAATGG GACGTGTGAT GAGGAAATAA TCAGGATTGA GGGTCAGGAT CGATGGCTTT     21600
     CCATCAGGCT TCACCACCCC TTCATAAACC CAGTTCGGGA TGTCGATTTC GACCTGATCG     21660
     ATCCTGTCAT GACTCGTCCG GCTCACGACT TTATAGCGTC CGATCAGCGG GAAGGATTCT     21720
     GTTTCACGGC GCTTCGACCG CCCTGTGTCC TTCGTCGAGA GGTTGGTGAT TTTAATACGG     21780
     GTTGCTTGCA GACGGTCTAA AGCGCGCTCA AGGTCCTCAT ATTGCTTTCC GCCCAATTCT     21840
     CGACGGCAGA ATTTAAGGAT CTCCGAGGCG GCAGGCCGGT AAACTCGTGG CGGCAATGAA     21900
     GGCCGCAGTC CTTTCGCTTC GTCGATCCGA TACTGGCGTG TGGCGTCCGC CAGGTGCGAG     21960
     ATCATATTGA TGACGATATC GTAATCATAG GCCGTGGCTA GACCGACGAC CGCGCCGCCT     22020
     TCGACGGTGA TGATCGAGTC TTTCAGCTCG TAGCGGATAA TCCCTTCCCC TGTCGTCTTG     22080
     GACAAGGCGA ATGGTGCTAT ATCCATAAGA TTGAAATCAT CCTTGATTGG TGCGTCATGG     22140
     ATGCTGGGAA CGAAAAATGA AAGCTGTGAA TCGTCTAATG GCGGCGCACG GACGATCGGT     22200
     TTTGGTTCGG TCGGAACTTC ATGGGATATG ACCCGGGCCA CTTCATCAGA GCGTATCGCT     22260
     TCAGCCAGTC GCGCCAGAGA TGATTTCAGA TCATCATCCG GTAATTGCTC GAGCCGAAGA     22320
     TCGGCCAAGC TGCGGCGGCT GTAATAGCGG CGAATACGGC TTAGTGCATC CTTGTCAAGC     22380
     GGCTTATAGG GATCGCCGCG TACATGGGCG ACATGCTGCG CTATGCCTTG AATATACTCG     22440
     TTTTTCTCAT GCAGCGACAA GACCGCGAAT TCGGCGCGTG ATTTGAGATT GAGTCGAGTG     22500
     GTCTTTGCCA TAGCTTACGA TAGGAATTGT CAACTTAAGT TATCTGATAC GCATCCACGT     22560
     CACGGAAGCT TCAGGCTGAA GGCATGGCTG TTGATCTCAG CCGGGAACGA AGACGGTCAT     22620
     GCGGATCAGG AGCAGCTTTC ATCGCGTTAT CCTGCCCTGC TTCAGGCAAT ATGCCAAGCC     22680
     TGATTAATGT GACGAAGCCC TGCGAGGCGG TTGGCCTGGC GCTGGCCGCT CGTTTCGACC     22740
     TAGCTGGAGG ATTATTTTAC GAGCGACCCA GCTGGCTATT TCAAGGGAAT GGTGAAGAAA     22800
     GCCGAAAAAG GCGAACTCTT CCTGGAAGGC TCCTTCTGGA CACTCCGTAA AGCCAATGCT     22860
     GGCAAAAGAC TTTGGGCGTT GAATATGGCG TTCATGCCAC GACACATGCG TCATCAAGGG     22920
     GCTCGAAGCA CAGATGGACG CTTATGTCCC TGGTAGGCTA ACTCGTTTGG TGATGGAAGC     22980
     TGCGGCTCAC CTGTGGATCT TGCAATGGCA CAGGGAGGAT TACCTGTCCA TGGGTCTTCA     23040
     ACACTTCTAC TCTGACGCAC TTTGATGCCA TCGGGGGCGT CTAGCTCATC GGGCTCGTCT     23100
     GCTTCCTCGG CTTCGTTCAT ATTTGTCTCA ACGGTCAAGA CGACGTCTTC AGCCACCGCT     23160
     GCGAGAAATG CTTCCAGCCA GTGGATGCTA TATTGGCCGT TCTGGATGTC GGCATTATTG     23220
     ACCAGCCTCT GAAACAAGGG AATCGTTGTC TTGATCCCGT CAACGATGAA TTCGTCGAGG     23280
     GCGCGGCGCA GCCGCATCAA GGCTTCCTTG CGGTTGGGAC CATGAACGAT GAGCTTACCG     23340
     ATAAGGGAGT CATAGGTTGG TGGAATCTTA TATCCTGCAT AGGCGGCACT ATCGATGCGA     23400
     ATGCCGATGC CACCAGGCGT ATGATATTGG CCGATCCTGC CGGGTGAGGG TGTGAATGTG     23460
     GTGGGATCTT CGGCATTGAT CCGGCATTCT ATGGCGTGAC CGCGAACGAC CACCTGATCC     23520
     TGGATAATGG ATAAGGGCTG GCCCGCTGCG ATCTTGATCT GTTCGTTGAC GAGATCAAAG     23580
     CCCGTGATCA TCTCTGTCAC TGGATGCTCG ACCTGAATGC GTGTATTCAT CTCAATGAAG     23640
     TAGAACTTGC CATCCTTGTA AAGAAATTCG ATCGTGCCGA CGCCTAAATA GCCGAGTTTA     23700
     CGCATTGCTA CGGCGCAGAT TTCGCAGATT TCCTCGCGTT GCGTTTCATC GAGCACGGGG     23760
     GAAGGGCTCT CTTCCCAGAC TTTTTGGTGA CGCCTTTGCA GGGAACAATC GCGCTCGCCA     23820
     AGATGGACCG CATTGCCGCG CCCATCGCCA AGAACCTGGA TTTCGATATG GCGAGGGTTT     23880
     TCGAGATATT TTTCGAGATA GACCGAGCCA TCACCGAAGG CAGCCTTTGC CTCGCTGGAG     23940
     GCGGTCGCGA CCGCGCTGGC AAATTCATCC CGGCTATGGG CTACTTTCAT GCCGCGTCCA     24000
     CCGCCTCCCG AGGCGGCCTT GATCAAGACA GGAAAGCCAA TGCCCTCTGC GATGTCCAAG     24060
     GCCTCTTCGG CATGATTGAG CGCGCCAGAC GAGCCCGGAA CGCAGGGAAT GCCGAGACTG     24120
     ATCGCGGTGC GTTTGGCTTC GATCTTATCG CCCATGATGC GGATATGTTC GGGCTTTGGA     24180
     CCGATGAAGG CGATATTATG CGCGGCGAGG ATTTCGGCGA AATGCGCATT TTCGGACAAG     24240
     AACCCATAGC CAGGATGGAC GGCTTCGGCG CCCGTGATCT GGCAAGCCGC GATAATGGCT     24300
     GGAATGTTCA AATAGGATTC TCGAGCGGGG GGCGGACCGA GACAGACCGA TTCATGCGCA     24360
     AGCTTGACAT GCATAGCTTC GGCATCGGCG GTCGAATGAA CGGCAACCGT GGAAATCCCG     24420
     AGCTCCTGCG CAGCTCGTAG AACACGCAGA GCAATTTCGC CGCGATTGGC AATGAGGATC     24480
     TTACTGAACA TACGCATTCC CCTCTTGTAT TTTTATATCA TGTATAGCTC ACGCTATTGT     24540
     CTCGAAATCA AAAGAGGTCC TGGCGGCGAT GAAGTCTGGC TACGACATCG CCGATTATCC     24600
     TAATCGGATA GGAAGTTCCG TTTCACTGAG TCTAATGCGC GGAGGAGTGA AGTGCTGACA     24660
     TAGACCGGGG TGGTGCCCCT TTCACTTCCC TCTCACTCAC GTGGCATTGA CTTCTATGTC     24720
     ATTGACTTGG TCTCATCTCG GCGAAGCTGG GGCCACTCAA GAAATAGGCG TCTACCCGCA     24780
     GACCGATCGG GAGCCTGACG CCAGGATCGA GATCGATCAA TACTTGCAAC ACCTTGGTGT     24840
     CGACCCGATC AGCAGGGCGA CCTGTCATCA CTTGTTTGGC GCCCATGCGT GTCGAGACGC     24900
     GATAGACTGT GCCGCCGAAT TTCTGATCCG GGAATGCATC GGCCGTGATC TCGACGCGCT     24960
     GGCCGACCGT GGCCTGGCTG ACATCGGTCT CATCAACTTC CGCGCGAACG CGCAGGCCAT     25020
     GCAGATTGCC GATGAGTGCG ATGGGTGTCG GTGGCTGGTT CGTGACAGCT TCACCAGCGA     25080
     TGCGAACGCG GCGCAGAACG ATCCCGGCGA TCGGGGAGCG GATGAGAGTC TTGTCGAGGA     25140
     GTGCGTCCGC CAAGGCTACA TTGGCCTCGG CGAGGCGGAC CTGGGCGCGT GCCGCCGCAA     25200
     TATCTTCCGG CCGTGTGCCT GCCTCGAGGA GGGCCAGCCT TTCAGCCATG ACTTCGCGCC     25260
     GCGCCGCAGT CGTATCGAGA TTCGCCGTCG CCACGTCGAG AGCCGCCATT GTCGAGGCGC     25320
     CCGTCTTTGC AAGGGGGACG CGGCGCTGAT ATTCGACGCG GGCGAGTTGG AGATTGGCTT     25380
     CGGCTTCCTT CAGAGCCGCG CGTGCCTCCT TTCGTTCCTC GGAACGGGCG CCATTGATGC     25440
     TCCGTTCGAG TTCTGCCTGC CTTAAGGCCA ACTCCGCCCG CGCTGAGGAC AACCTTGCAA     25500
     CCTGCTCGTC ATTCTCGATC ACCGCGATGA TTTGTCCTTC ATGCACTTCG TCGTTTTCTT     25560
     CGACACGGAC CTCGTGGATG ATGCCAATCA CCTGAGATCC GATTTCACGC TCCTCGCTGA     25620
     CAGGCTCGAC CAGCCCGGGA GCCGCGGCCA AATGCTGTCG GGACACCGGA CTGATCGAGG     25680
     GTTGCGTCTG CGCAAAGGTT GGCGCTTGCG CGGGCCATAC TATGGCTACC AAGCCAAGCG     25740
     AGGTCAGGAG CACCATGGCG AGCCAAGAGG TTTTCATGAC GAATGTCCCA TTGTAAGACT     25800
     TTGAGAATCT GGAAGAATAC TTGAACGCTC GACAATGCGA CCGTCCTCGA GATGCACGAC     25860
     GCGATCTGCG AAAGGAAAAA TTCGGGGATC ATGTGTCACG ATGACAACGG CGCGATGCTG     25920
     GTGATGAGCC AGCATACAGA AGAGTTCCAT GGCCTTGAGG CCTGTCTCGG CATCGAGGGC     25980
     AGCGGTCGGC TCATCGGCCA TGAGGATGGG CGGATCGCTG GCAAGGGCGC GGGCGATTGC     26040
     GACGCGCTGT TTCTGGCCGC TGCTGAGCTG CGCGGGATAG CTATCAAGAC GGTGTCCGAG     26100
     GCCCACGAGT TTCAGAAGCT CATGCGCGCG TTCCTGGGCG GCGCGTCTCT TCACCCCCAG     26160
     GAGATCGAGC GTGACCATGA CGTTTTCCGT GGCCGTGAGC ACGGGAAACA AATTATAAGC     26220
     TTGAAAAACA AAGCCGAAAT GTTGCAACCG CAGCGAGGCA AGTTGCTCCT CGTTGAGCGA     26280
     TTGTGTCGTT TTCCCACGCA GATCGATGAT CCCTGCGGTC GGCTTGAGAA GGCAGCCGAG     26340
     GATATTGAGC AGCGTGGTCT TGCCACTGCC GGATGGACCC ACGAGCATTA ACACCTCGTT     26400
     GGTATAAATC TTGAGATCGA TCTCTCGCAG CACCGTGAAA CGTGTGGTGC TGGAGCCGAA     26460
     TGTATGCGTG ATGTTGGAGG CAATGACGAC CGGCTGTTTC ATCGAAACAC CTTCACGGGG     26520
     TCTATGGCTG TGACCTTGTT CAGGGATACC AATGATGCGC TGATGCACAT CAAGATGGTG     26580
     ATAACCCCGA TCCCCGAGGC GAGCCATAAA GGCACTTGCG GAGGGGAGCT GCTGTTGCGA     26640
     GAGAGATAGG CGAGCAGCAG GACAACGCTA ATGCCGGTCA GCCCCCCCAG AACCCCGCCA     26700
     ATGACGGCTT GCTTGATCAC GATTTTATAC AAATAGGATC GTGGGCCGCC CATGGCCCGG     26760
     ACAACGGCAT ATTCTGGCAG CCGGTCCAGA GTGCTCGCAT AGAGCGTCTG TGCAACGATA     26820
     ACGACACCCA CCAGGAGCGC CAGCAAGGAT GAACTGATAA GTGTGATACC AGCACCCGTC     26880
     GTGAATAACC AATAACTCCG GCTCCTGTGC GAGAACTCGT CCGTTGGCAG CACGTCGACA     26940
     TCCGGCATGC GTGTGGAAAG TGCCCGGATG ACGGGTTCGG GTGCCTGTCC TTCCAGAAGC     27000
     TTGATCAATA CATAGGTTAT GTCTTTGTCG CCAAGATCCG ACAGCAGCCT CGCATTGCGC     27060
     AGCGATGTGA AGACATAAGG TGCCTGGGTA AAGGTCCGGA TGCCTTCGGT AAAGCCAGCG     27120
     ACGCGGGCGC GGTGATTGTT GATTTCGACG ATTTGACCAA TGGATGTGAC GCCGAGTTTC     27180
     TGCGCATAAA GGCGATCGAT GATCACTCCA TCGGGGGTCG ACAGGGCATC ATGGACATTC     27240
     TGACCAGGCG TCATTGACGG CAGCAATCCC ATTTCGGCAT TTGGTTCCAC GCCAATGACG     27300
     AGGACCAATT CGCGAACGCC GTTGGATCGT TTCCAAGAGC CGAAATGCAG CAACATCGGC     27360
     TCGGCCTTGG CGATCCCATC GACAGCGAGC GATTGGAATC GTCGCCGCTC TTCGATCGGG     27420
     GTCGCGAGAT CGACGCTGCG CACTCCTTGC ACCGCGACCC AGAGATCCGC GCCGGCCTGA     27480
     TCGACGATCG TCGAGGTCGT ATGCATGAAA TTCAGCAACA TGCCGAGCTG AATGCCCATC     27540
     AAAACCGTCG AGAAAGCAAT ACCGACGAGC GTTACGGCGA AACGGACCCG GTCATGAACG     27600
     AGGTTGCGCC ACGCGATGAG AAGCGTCAGG CTTGAATGCC CACGCGGGAC TGCCTGGGGG     27660
     CGCTGGAAAC TCTTGGTGAG TAGGCCGACA CTATCTGCTG AAGACATTAG CGGGACTCCG     27720
     CAAAGTTCGC TGTCCTGTTG CCAGAGATCC GCTTTGGGAA CTTCAGCCGC AGTTGAAGAG     27780
     GCAATCCATC GATATCGCTT CCAAAAATTC GTTCCGATGT TGCCGCGGTC TGGTCATATG     27840
     CCCATGTATC CGGCATGGTG CCCGCACTCG CAAGTCTAGG CATAGATACA CAAATGGTTA     27900
     TGCCGCAAAG GCGAAATCGC AAGATATCGA GCATCGTTTG TTGTCGCATC ATCAATTTTC     27960
     TCTTCTTATG AAGCTCTAAC ACGGCTTGTT GATCCGTATT CTTCACCGAA GCGTCGATTG     28020
     AGTGATAGAT TTAGGTGTTC CAATATATTG TTTGCCATGT GCTCGGCGCT GAACCGTGCC     28080
     GCCAGCGCCC TGGTGTTCGC GGCAAGTTCC GCATGGAGAT CATCATCCTT CAGCAGGCGC     28140
     TCGAGCTGCC GTGCCAGATC GGCGCTGTCC CAGGTCTTGA ATGTCAAGCC ACCGGCAATG     28200
     TTTCCATGCT GGATGACTTC CGTCACCCCG CCAATGTCTG GGACCAGCAC AGGCGTCCCT     28260
     TGGCTCATGG CCTCGGCGAC AACCAGCCCG AACGCCTCCC GATCAACGGA AGGGTAGACG     28320
     ATACAGCGAC TATGCGCGTA GAGAGCGTCA CGCACCTCGA ACGAAACAGC ACCACTATGG     28380
     TTGATGACGA GCTTCAAATG ACTCGTGAGA TCGTTGATGA CCTTCTGATA CGAACGCCCT     28440
     TTTGCAGTGG AGCCGCAAAT GACGAGCTGC AGGTGAACGC CGCGTACTGC CAAAAGTTTT     28500
     GCTGCATAAA GTAAAAGGTC GATTCCCTTC TCGCTTTCCT GGCGTCCAAT GAATGTGACA     28560
     ATGGCACCGT CTTGGGCATC GTCTTGCCTC ACTTTCGGAA AGGCCGTCTT GAGGATTGAA     28620
     AAGGGAAGCC TCTGCTCCTG TTTGGGGAGG TCGATACCGT TATAGATGAC CCGGAAGCAA     28680
     TTAGGGTCCA GCCCGAGCTC AGTGACAAGA CGTTGAAGAT AATCCCGGCT GATCGCTATT     28740
     GCGGGCCAGC CCGAGTTGCG GACCGCTTCG TCCAGCCGGC GCCGATAGTT TTGGAGCAAT     28800
     CCGGCTTTTG CGGCGAAATC GGCAAATTGT TCATCACCCT GGAACGTAAC GAGATAATCG     28860
     AGCGGCACTT TGCAAAGCTT CTTAACCTCG AGGGCCAGGG GGCTGATGGA GCCGAAACTC     28920
     ATCATCAGAT GCGTAACGCC GTCCAACTCC ACATATTTAA GCAATCTCTT GACAAGCGAA     28980
     GGATCAGGAT CCGACTCCGT ATAAAGCGAG CGCATGAGGT TTTGCAGAAG ACGATCGACA     29040
     AAGCCGGGAA TGTTTTGGAC GATATTGGTG CGCCAGCCTT TCGGGAAAAA AGACAGAAGC     29100
     GGTCCAACTA TTCTGTCCAA AAATTCGGAC GGTTGCTTGA ATTGATATCG TGTGCCGTAA     29160
     CAAAGAATCC TCTGTTCGAT CCCATTGATG ACAAGGTCAG GATTATGCTC GAGCATCCAA     29220
     TAGATTACGA CCTTGAAACC ACGTTTGTAC AGGGAATGAG CGAGCGTTAG GTCCCGAATG     29280
     GTGGAACCCA GATACGATCC ACTTCCTATA GTGACAAAGG CAAAGGTTGG GTTCTGTGCC     29340
     ATAGAGGAGT TCCATCGTTT ATGCCGCTCG GAATATAGAG ATGGATCATT TTTCTACCGC     29400
     GATGGTCACG TGTTCGGTTA ATGAATGTAT CACCGACAGA ACCATTTCAT AAGCCATGAT     29460
     GAATACGCAA AGCCTATCCA AAAATTGTAT AGGCTGACTC GCTTTTGTGA CCAAAACTCG     29520
     AATGTGGCTG ACTTGCATAG GCGATGATGA AGCCACAGTC CTCCACGGTC TTCACCTCAA     29580
     AGGAGCGAGC GCTTGTCTGA TGCTTGATCT CAATCCGCCC GCCGTTTTCC AGCTGGATTG     29640
     CTTCGAACGC TTGAGGCAAG CCATTGATCC CTGTGCCCAG AAGCTTACCG GTGGCCTCCT     29700
     TGGCGCACCA GAGTCGTGTA ATCCATGTCT GGTGTTCCAC CTGTGGAAAC TTTGCAATCA     29760
     AGTTACGCTC GTGTGCCGTG GTAAAGGCCT GGATGAAGCT GGCATCGTGT TCGGCGATAC     29820
     GCTCAATATC CACACCTACG GCTTCGGTAT GCGCCACGGC TATTGCTCTG GTCTCACTGT     29880
     GAGCGATGCT CACGAGTGGC GGCGTATTGC ACCCCGGGAG CGCCCTGACG AATGGGCGTC     29940
     CCTGTCCATC ATTATCAATG GTGAAGGCTG CGGGATGCAG CATGGGAGCC TGCGTTTGCT     30000
     CGGCGGCCCA CAGACGCACG GCGTCCTTGG CCACGACGCG CCCAAGCAGC CATTGTTTCT     30060
     GGCGTTGGGG GATACGGGCA TGACCGTTAA AGACTGGCAT TTCTTCCATG CTCAAGCAAT     30120
     GCCGCGCCAA TATGCTGAAA TCAAAATTTT GAAACTCGGC AGTGGTCACC GTCAGGCATA     30180
     CGGATCCGTC GCCCGAGTTG GGCAGAGGCG CCGCTCGGCC AAGCAGGTAT TGGTCGGGAA     30240
     AGCGGCGGAA ATCCACTAGG CATTGCTCCC AGTTGAACTT CCAGCTTCCC CAATCCACGA     30300
     TGCGCATCCA CACGGCGCCA GCGCCGTCCT GGACCTCGAC ATTGGCGAGG AGCCGCTTGC     30360
     CTTCTGTCTG GGTGATCTCC ACCCGCACTG GAACACGGGT CCCAACCGGG GGGGAGGGGC     30420
     AATAGATCTC GAGTTTCGCA AGACCAATGG GGAAGACATA GCGGCCATGC TCCATGGCCC     30480
     AGACGCCTAA GATCTGGCCG ATGCCATCGA GCAAAGCCGG GTCGATGAGG AGTTGTGGGC     30540
     TACGGGTTGA CCCAAACAGG TCCTCAGGGG AATGCCTGAC GAATTCACCT ATAATCCCAT     30600
     GATCACCGAC GATGATCTCA CCGGACAGGC AGTGAAAGCT CGGTCCATGA AACATATGGC     30660
     GCTCGCCATA GATCTCTTCA CCGGTGAGAG GATGCCGATA GGGATTGGCC AGTTCGGTGA     30720
     AAGCGGGAGA TAATTCGATG AGATAGTGAT CGCCAAACAG CACCATCGCG CTGATCGCGG     30780
     GCCGGGTCTG CCCCTCGATA AAGACCTCGA CCCTGATGAA GGAGGCGCCG CGATCTTCGT     30840
     CATGGCGATC GACCCGCGCC GTGATATGCA GCGTCAGGAC ATCCGTATCC GCCAATTCGA     30900
     TCCAACGGGT GGCCTTGACG TCTTCAAAGC CCAGCAAGCC ATAGCCGGGG ACGAGACAGG     30960
     CCGCGACCTC CGCCATGACT TCGAGGCTCA TGGTCATGGG CAGCACTGGC AGGCAGGCGG     31020
     AGGCTGGCTT GACGCCTGGC GCATGGACGA AGGCATGATC GGCGAGGTAG CGATCCCCCT     31080
     CCAGCGTCAA GTGCCGCTCG ACTGTGATGG TCTCCCCTGG AACATAGGCC AAGACCGGGC     31140
     CCAGAAAAGG CAGAATGGCC TCGTTCTGGG CCTCATCCAT TGTTGCTGTG TGGACAGGCT     31200
     GGGACGCCGT GCTCGAGGGG GTAGGAATTG GTGGCTCGGG GTTTCCAAGG TCCTCATGCA     31260
     CGGCCACGGC CAGGGCCAAC TCCTCCGCTG CTCGGGCCTC GAACACACGT CCGATCAATG     31320
     GCAAGTCGCC GACACTTGGC TGCTTCGGGA CAGGGGTTCC CATATGTCTA CCTCCCTACT     31380
     CAACAATTAT CTCTTCATTC AACGCTCATA TCTTCTCCAG CACTGATCCG CTGGCTGTCA     31440
     GGCCAGGCCC GAAGCCGAGG CAAACAATGC GTGTGCCTAC GGGAATCCCG GGCTCTTCCA     31500
     CGATCGCCTT GAAGATGTGC GGGACCGTTG CCGAGGACAT GTTGCCGTTC TCGGCGAAGA     31560
     CGGATTTGCT GATGGCCACC TGATCATCAT CAAGACCCAG GGCGTCTTGA ATATGTTCAA     31620
     CGATCTTTGG CCCACCTGGA TGAATGGCGA AAGCGAGGTG CCGCCGTTCA CGCTCGAAGT     31680
     CGATTCCGAC CTGTTGCAGC AAGGCTTCCA CGAAAGGTCG GACCCATTGC TTGATGATCA     31740
     CAGGCACCAT CACCGAGAGC GTCATGTGAA AGTGTGTTGA ACCGGGCATC CAGGTCATGT     31800
     CCTTGGCTGA ATTGGGGAGC ACGTGCTCGT TGAACGCCAG GATCTTCAAA CCGTGCTGAC     31860
     CGCGCTTGCG CAGGGATTCC TCGGAGACCA CGGAATATTT GATGAAGCCG TCTGAAAACA     31920
     GCGTCGAAGT GATAATATTC TCTACTTTAG GATTCTCGAC ACCGATATGA GCCGACAGCA     31980
     CTTCGGTGTG GACGATGTCC ACACGCTTTT TGGGTGGTGT CACGCCGGAT TGCGAGGAGG     32040
     ACAGGAATCC ATGCGCCATC TTGATGGCCG GGAAAGCCCC GTGACAGCAC ATGTGATAGC     32100
     TGTGCGTCAC CGTCGTGTTG AACCAGTTCT TGTCAGCCGC CAGCTTCTCG GCGGGACTTG     32160
     GGGCGAGATA GCCAGAACAG GTCACATGGA TTAGATCATC GGGAGCCTCG GATTCATCGC     32220
     CATACATTTC CGCCAGGCAG TCATCCGTGA TTTTAGCGTA GCTCTCGTGA CGGGTCTTGA     32280
     TGTCCTTGGC GTTCAAGCTC TCGTAATTAT CAAAGAGCTT CATGTATTCA TGCTCGGGCT     32340
     CCATGAGCCT GAATTCACCA TTGCTGAACT GAATGTCCTT CATACGCGGG AAGAACACCA     32400
     GCTGCCGTCG TTTGATCACA GATGGTGACA AGGCATAATT ATCGAATTTC TCTCGGATTT     32460
     CCTTGTGGAC CTTGTCAAAG TCTTCCTTCT CGGTAATGCC CTGATTCCGG CAATAGGTCT     32520
     TGGCGAAACC CCAAGCCGAT ATTTCCAATG TCACGGCTTG AGGGGTGGGT TCGACCAATT     32580
     GAACCGGAAC GAAATCGGCC AAGACAGGCT GGTTATAAAG CGACATGCTA TTATACCTCC     32640
     CTATGGCATA TATGATTGCA TAAAACAATA TATAAAACGA CATGTGTAAA TATATTAAAA     32700
     TAATTATTTC AGTAATTTGG CAAAAAATTG TCGCTATACT TGAGTGTCTT GTGAATAATT     32760
     ACAAGTTGCC GCCACTCATC TGCTTCCCAT GTGCAGCATG AGGCTTAATA TAACTATGCC     32820
     TATGTTCTAG TCTGTGCTCA TATCTTCTCC AGCATCAATC CTGTGACTGT CAGGCCAGGC     32880
     CAGGCCAGGC CAGGCCGGAA GCCGAGGCCT GCGATGTGTG CCACTGGGAT TCTGGGCTCT     32940
     TCCATGGTTT TCTTGAAGAT GTAAGGGGTC GTCGCCGAGG GTATGTTGTC GTGCTCGGCG     33000
     ACGACGGATT TGCTGATGGC CACTTGATCC TCGTCGAGAT TCAGAACGTC TTGTCCATGC     33060
     ATGATGATCT TTGGCCCACC CGGATACTCC TTCTGTTCAT TTGACTAAGA TAAGTTGCAG     33120
     GCGCCCGGCT GCTTCGGAAA CGTGACAGGA AGCTCCATAT GACTATGCCT GCGTCCTACG     33180
     CGACGCTCAT ATCTTCTCCA GCACCAGTCC GGTGGCTGTC AGGCCAGGCC CGAAGCCGAG     33240
     GCAAACAATG CGTGTGCCTA CGGGAATCCC GGGCTCTTCC ACGATCGCCT TGAAGATGTG     33300
     CGGGACCGTT GCCGAGGACA TGTTGCCGTT CTCGGCGAAG ACGGATTTGC TGATGGCCAC     33360
     CTGATCATCA TCAAGACCCA GGGCGTCTTG AATATGTTCA ACGATCTTTG GCCCACCTGG     33420
     ATGAATGGCG AAAGCGAGGT GCCGCCGTTC ACGCTCGAAG TCGATTCCGA CCTGTTGCAG     33480
     CAAGGCTTCC ACGAAAGGTC GGACCCATTG CTTGATGATC ACAGGCACCA TCACCGAGAG     33540
     CGTCATGTGA AAGCGCGTCG AACCTGGTAC CCAGGTCATG TCACTGGTTG AATTGGGGAG     33600
     CACATGCTCG TTGAACGCCA GGATCTTCAA GCCGTGCTGA CCGCGCTTGC GCAGGGACTC     33660
     CTCGGAGACC ACGGAATATT TGATGAAGCC GTCTGAAAAC AGCGTCATGG TGACGATGTT     33720
     CTCAGCCTTG GGACTCTCGA CACCGATATG AGCCGACAGC ACTTCGGTGT GGACGATGTC     33780
     CACGCGCTCC TTGGGCGGTG TCACGCCGAA TTGCGAGGAG GACAGGAATC CATGCGCCAT     33840
     CTTGATGGCC GGGAAAGCCC CGTAACAGCC CATGTGATAG CTGTGCGTCA CCGTCGTGTT     33900
     GAACCAGTTC TTGTTGGATA CCATCCGCTC GACGGGACTG GGTGCGAGAT AGCCAGAACA     33960
     GGTCACATGG ATCAAATCAT CGGGGGCTTC GGATTCATCG CCATACATTT CCTCCAAGCA     34020
     ATCAGTGGCG ACCTTGGCGT AGCTGTCGTG GCGGGTCTTG ATGTCCTTGG CGTTCAGATT     34080
     GTCATAGCTA TCGAAGAGCT GCATGTATTC ATGCTCGGGC TCCATGAGCC TGAATTCACC     34140
     ATTGCTGAAC TGAATGTCCT TCATACGTGG GAAGAACACC AGCTGCCGTC GTTTGATCAC     34200
     AGATGGTGAC AAGGCGTAAT TATCGAATTT CTCTCGGATT TCCTTGTGGA CCTTGTCAAA     34260
     ACCTTCCTTC TCGGTAATGC CCTGATTCCG GCAATAGGTC TTGGCGAAGC CCCAAGCCGA     34320
     TATTTCCAAT GTCACGGCTT GAGGGGTGGG TTCGACCAAT TGAACCGGAA CGAAGTCGGC     34380
     CAAGACAGGC TGGTGGTAAT TGAGCATATG AGACTACTCC TTGGGTGCGT TTGACCTGCG     34440
     GGTCTATTGG CGCAAGGCTA GTTGGGCGAT CTGCTGTAGA CTTGCAGCCA CGACGATCTC     34500
     GGGCTTGCCG CTATTGCTGC GTCCGAGTTC CTCAAGGCAA CGCTGCCTTC CTTCTGCTAC     34560
     TGGTATGGGA TGGATGTTCT TGGTGGCATA GAGTCTGCGG AGCTCATCGC TCACCATGCC     34620
     GCCATCCCAA GGCCCCCAAT TGATCGCAAT CGTATGGACA TGGGGCCAGT CATGGCTCAG     34680
     CCGGTCGGCG AGCTTGTTCA CGACCTCATT GGCCGCGCTA TAGTCGGATT GACCGGCATT     34740
     GCCGAAACGG CCCGCGATGG AAGAGAAGAA CATCAGGAAC TTCAGGCCCT CGGGCCGTAG     34800
     CTTATTGGCC AGGACCGTCG CGGGAACGAC CTTGGTCGTG AACACGATAT CGAAGGATTC     34860
     CGGGGATTTG TCGCGGATCG ACTTGTCGTC GATCACGCCG GCGCCATGGA GTACGCCGTC     34920
     GATACGTCCC CAGCGTGCAT AGACATCGTC GATGAGACGG CCGAAGGCCT CACCATCTCG     34980
     GATGTCCAAG GTGTGATAGT CCACCTCTGC CCCGGCTGCC CGCATCGCCG CGAGATTGGC     35040
     GCGGATCTGT CGGTCTCGGA GCATCCGCTT GAGGGCGCGA TTGACCTCAG CTGGTGTGGT     35100
     CTTCGGGTTC TGCGCGCGCA ATTCGTGGAT CAGATATTGC TGCAATTGCT GCGGCTCAAC     35160
     CAGGTCGCGG GTCGCCTTGG CTTCCTCCTC GGGCATCGGG CTGCGTCCCA CCAGCACGAG     35220
     GCGCGGGTGG AATTTCTCCG CGAGCGCCTG CGTGACATCG GCGGTAATGC CATAGGCTCC     35280
     CCCGGTCACG AGCAGCACCG AGTTTGAATC CAGGTCCAAG GTTGAGAGAT CCGCGGCGGT     35340
     GGCGCTGCCT TTGCCGAGAT CGAGCTTCCA GCGCTCCTTC GGGGTGAATC CTACCTCTAC     35400
     CGTCTGGTCG TCATTGCCGA CTTCGCGCAG CACTTCGGTG ACCAGATGAT GGAGGTCGAT     35460
     GTCGGGATCC ACATCGATAC ATTTCACCCG TATCCCGGGC CATTCCCGGG CCACTGACTT     35520
     GGCCACTCCC AAGGTTCCCG CATGCAGGGC CGGAAAGGCA CGGGTCTGCC GCAGGCCGAA     35580
     TTGCCCATCG AAAGCGGTCA AATTGATCAA CCAACCGCCG CCGATCGGAG CACTTTCCTT     35640
     GAGGTCCGTT TCGAGCACTT TCAGGAGGAG GAACAAACGA CGGGCATATT CGAGATGCTG     35700
     GTCGTTGGCA GCATCGGCGA TTGTTCCCAG ACCTGCCAGG TTGAAGAGGG CGCCGACCTT     35760
     TTGTCCCTTC TCAGCAATGA GCGCGCGGAG CTTGCTTACG CCGTCCAGTG AAGAGAAATC     35820
     GACTTCAATG CGATCCTCAT CAAGGACATG GGTGTCGGTG CCGGAAACAA TCTGCCGGAC     35880
     GTGATAGTGC TTGGCTGTCA GCCGATCTCG GAACGCAGTC CCCAGGATCG GCACGTCGCC     35940
     GACTAACAGG ATCAGCCGAT CGGCCGGAAA GCCGTTCATC TCGGCCATGC CATCCCGTGG     36000
     GGCCGCCACG GGGGTGACGG TATAACGCTG CACTTCGTCA GCGCTTGCCA TGATCTCGAT     36060
     TGACTCCGCT GCCTCAGGCA AGGACACCGA CGACGGAGTC TGGGATTTTT TTACGGAATC     36120
     GGCCCCTTCC GGCATGGCCA TGCTCTGATG CAGGCCGTCA TACCAGTCGA TCACCGCATT     36180
     CAAGGTTTTG AGACTGGACA ATTCCTCGAA CACGGTCTCC TCGGCACGTC CCTCCATGAA     36240
     GGGATATTGG TCCTTGAGCT TGCTGAAGAT CTCGATCCGT TTGATGGAAT CGATGCCGAG     36300
     ATCAGCTTCC ATATGGGCGT CGAGGTCCAG CATGTCCTCG GAATAGCCGG TGCGCTCGGC     36360
     CGCCGCGTGC AGGAGATCGG CCTTGAACTG TTCCGTTGGC GCGAATGCTT TCTCACCGGT     36420
     CGCATGAGCA TCGGTCGTGC TCTTGGCCTT CAGGATGACA TGATCCGCCG CAGAGCCGTT     36480
     CGTTCCTACC CCGGAATTCT GTGGCGCGGC CGTCTCGAGC AAGGAGACTG ACGCTGCAAG     36540
     GGGAGGGATT TTTATCGGAT CCGCGCCCCC TCCCGGTTTT GCCAGGGTCT GACGCAGGCC     36600
     GTCATACCAG TTGATCACCG CATTCAAGGT TTTGAGGCTG GACAATTCCT CGAACACGGT     36660
     CTCCTCGGCA CGTCCCTCCA TGAAGGGATA TTGGTCCTTG AGCTTGCTGA AGATCTCGAT     36720
     CCGTTTGATG GAATCGATGC CAAGATCAGC TTCCATATGG GCGTCGAGGT CCAGCATGTC     36780
     CTCGGAATAG CCGGTGCGCT CGGATGCCGC GCGCAGAAGA TCGGCCTTGA ACTGTTCGGT     36840
     TGGCGCGAAT GCTTTCGCAT CGGTCGTGTT CTTGGCCTTG GCGCTGCCGT TTCCAGACAT     36900
     TGCTGGAGCT CTCGCCGGCA CGGCGTTCAG GGTGGGGGAA GCGAAAGCGG CTGGAGCGGG     36960
     TTGCGTGGGT TTAGCTCCAT GCGGACTTGG TGCGACCGCG AATTTCGGCA GCACGGGAGC     37020
     CGGGGGGACT ATTGTCGCGG CCGGTGCCCT GGCTGGGACA GGAGGAAGTT GCGCAGGAAG     37080
     GGGTTGCACA TTGGCTAGCG CCAACACCGA ATTCGAAGGA GCGGTCATCT CCGGACGTTG     37140
     TCCGGTGAGC CAATGTTCCT GGAACTCGAA GAAGCGCCTA AGGGTCTCTT GCTGTGTACG     37200
     CTGCAAATCG ATGAGCTGCG CTAAACTGCC TTGGACCTCG GTAAACCGCG ATTCAGATCC     37260
     TAAAGCATAG GCCGCTGGGG GGCTGGCGGC GATTCTCGAT GATGGATCGT AATTGGACAC     37320
     AACGGGTCTC CCCTCACGCT CGACAAAGGA ATTTTGGCTT GCTGGTGCGG CGGTGCTCCC     37380
     GCTCGCTCGC TCGGCAGCGG CCGGATTGAT CGCGGGACGG GCTAGCCCGT TTGGCAATGC     37440
     GCCATCCTGC GCTGCTTGTG TATTAATGGG CTTGTGTATG CTGGGTGCCG ACAAGCTGGG     37500
     TGTTTTGGGC GGTGTAGGTA TCTTGGTGGA TGCCTGGGAA GGGGCCTGGA TGGGTGTATA     37560
     CCAGGGAACC GCCTTGCCGC CGTTGACGCG CCAGACCATG GGGCCCGGCT GCGCCTTTGC     37620
     GCGGGCTTGC GCGAGTGTCT GTTCCAGATT CGTATCCGCC AGCCCGCGCC GCTGGAACCA     37680
     GGGCTCCAGA TTGATCGGCA GCCCGAGGGA GAACACTTGG GCGAGCAGAT GGGCGAATTG     37740
     CAGCCAGCCG GGCCGATCCG GCACGTCAAT GCCCAGGCTG ACATGAGGTC TGTCACCCAG     37800
     GATGCGGTCC ACGAGCCCGC TCAACACGAG TCCCGGCCCC GCCTCGATGA AGACCCGCGC     37860
     CCCCGCTTCA TAGAGATGCT GGATCTCGTC CACGAAACGC AAAGGCTCGG CGATATGGCG     37920
     TGCGAGCAGG GCCTGGATCT CGCCGGGATC GTCGGGATAA CGATTCCCGG TGGTATTGCT     37980
     GAAGAGTGAG ATCTGAGGGC GTTGGAACGT GATCTTGGCG AGTTCGGCTG CGAGAGCCTC     38040
     TTGCGCCTCG GCCATGGCGG CGCAATGGAA AGCCGCCGTG ACCGCAATCG GTTTGATCCG     38100
     CAGGGACTCC TGGATCAAGG CCTTGACCGC CGCATCGATG GCTTCGGCAG AGCCGGCGAT     38160
     AATGGTCTGA TCGGGGGCAT TGAGATTGGC CACGCTCACG GCCAATCCAA GGCGATTGAT     38220
     CGCCTCAACG ACCCGGGCCT CATCGGCATT GACCGCCGCC ATGGTCCCGG ATTCCGCCTT     38280
     GGAGGTCTGC GCCGCGATGC GGCCGCGCAC TTCGGAGAGC CGGATCAGAT CATCGCGTGA     38340
     GATCACGCCT GCGGCGCAGA GCGCGACATA TTCGCCGTAA CTGTGACCAG CCACGAAATT     38400
     CGGCCGCAGC CCGAAGGATG TGAGGAAATC AAGGGCTGTT AAATCAATTA CGCCGAGGGC     38460
     CGGCTGCGCC ACATGGGTAT CATTCAGGGC CTTTTGCTGC TGTTCCTGCT CCTCCTTGGT     38520
     GAAACTGGGC AGCGGATAGA TATAGCGCGA CAAAGGTTGT GGCAGGGCTT CTTTGAGCAA     38580
     GGCGTCGGCC CGCTCGAAGA GCGCATAGCT AGCAGGACGT GTGAGCACGA GGTCACGCAA     38640
     CATGTTGATC CGTTGCGATC CCTGACCCGA GAACAGCATA CAGACAGCGC CACTGTCTTC     38700
     GCGGTGCTCC TGTTCCCGGT AATAGATGCC CTGCGGCGCT TTGATGCTGG TCTTGTCCTT     38760
     GGATTCGCGC AGGAAGAACT CTAGCTTGGT TTTGAGATCA GCGACCGAAC TTGCTACAAT     38820
     GGCGAGCTGG CATGTGAGCG CACCGTTCTT CGGCCGAACC CTGGCCTCAT CGAGATGGAC     38880
     CGCATAGGCG AGCTGGGCGA GGTTCAGATG CTCGGGCTGG GCGAGCCCCT GCAATAAGGT     38940
     CCTGACGGCT TGTTCGACCT CGGGGCGCTT GGCGCGGCCG AAGGCGAAAA TCTCGGCGGC     39000
     GCGCGGGTTC AAGTCCTGGC TGTCCGAGGG TCTATATTCG CCGCGATATT CCTCCAGGAC     39060
     CGTATGAAAA TTGGTGCCCC CGAAGCCGAA GGCGCTGACG CCGCATCGGC GTGGCTGCCC     39120
     TTCGGGCATG CCGAGCCACG GCCTGGCTTC AGTATTGATA TAGAATGGTG TGTTGGGGAA     39180
     ATCGACCCGC GATGAGGGCC GTTCCACTCC AAGGGTTGGG GGCAGTACGC GATGCTTGAG     39240
     CGCCAGGCTA GCTTTGATCA GGGCGGCCAG GCCAGCGGTC ACCTTGGTAT GCCCGATCAT     39300
     GGATTTCACC GATCCAACCG CGCAATATTG ATGCTGCGTG CTGGCGGTCC CAAAGGCGAG     39360
     GTTCAGCGAC TCGATCTCCG ACCTGTCACC GAGCGCGGTG CCCGTGCCAT GCGCTTCAAT     39420
     CAAGGTCACG CTGGCCGGAT CCACGCCTGC ATCCGCGTAA GCCCGCTCGA TCGCGCGGAC     39480
     CTGGCCTTGA GGATGCGGAG CTGTCAGGCT GCGGTTGTGC CCGTCACTGG AACTGCCGAT     39540
     GCCCTTGATG ACAGCATAGA TCTTGTCACC GTCGCGTTCG GCGTCAGTGA GGCGTTTCAG     39600
     CACCACCGCG GCGACACCCT CGCCAAGAGC AATCCCGTCG GCGCTATCAT CGAAGGGACG     39660
     GCAACGCCCC CGTGGCGAAA GCGCATGGGT TTGGGCGAAG GTCATGAACC CGAGAACATT     39720
     GTTGGCGCCA TCGACCGATC CGACCAGGGC GACATCGGCA TCGCCGCTGC GCAACTGGCG     39780
     GATGCCGGTA TCGAGCGCGG CAAGGGAGGC GGCACAAGCG GCGTCCACGG TGAAATTGGT     39840
     GCCGCGCAAG TCAAGGCGAT TGGCCACACG CCCCGAGACC ACATTGGCGA GCATGCCCGG     39900
     AAAGGAATCT TCGGTCCATT TGGGCAAGTC GTGTTCACAG AGGGAATCGA GAATGCGTTT     39960
     GCGGTTGTCC TCCGAGACAC CTTCCACTTT CGGTAAGTAA TGAGTCAAAA GGGTCCGGAA     40020
     GATATAGTCC ATCCCGAGAT CGTTCATGCC GCTGGCGGCG AAGATCGTAG CGGTGCGTTC     40080
     GCGTGGGAAA GGCCGGCGAT CAAACCCGGC ATCTTCCAGG GCCTTGCTCG CGATATGCAG     40140
     AGCCAGAAGC TGTATGGGTT CGATGGAGCG CAGACTTGCC GGCGGAATGC CGTAGTGGGT     40200
     CGGATCGAAG GCGACATCGT CGAGGAAGCC GCCCCATCTG GAATAGACTT TGTCCTTGAT     40260
     TCCCCGTTTA GGATCGAAAA AATCGTCTGC CCGCCAGCGA GACTCCGGCA CTTCGCGGAT     40320
     CGCATTGACC GCGAGCATGA TATTCTGCCA GTAGCTCGGC AGGTCACTCG CCCCGGGCAG     40380
     CAGGGACGCC ATACCCACGA TGGCGATGTC CTCATGCGGT TTGGGCATGG CCGGATGTTT     40440
     GTGTTCGGCT TGTCTGAGTG CGGCTTGGGC CAGTACCGCT GTTGCCTCCG CGGAGACATC     40500
     ATTGTGTAAC TCAGCCATGC TGACTCTGGC TTTGCGCAAC CGCGCCACTT CTCCCATCAT     40560
     ATACAGACCT TCGCGGCGCT GGGTCTCTAC ATCAAGGCCG GTATAGCGGT CGGTGCCGTC     40620
     GCTGGCCGTA GAATTGGCGT TGCGAGATAC TCCTTTGGAG GCGATGCGCA GACGGCCAAT     40680
     GTTGAGGAGT TCCAGCTCCA TGAGGATTTG GTCGTCGGAT TTGGTGTCGA GCAGCAGCTC     40740
     GTTTCTTTTG TCGTCGAACT CATTGCAGAA GTTCGTTTTG GCGCAGCGGG TATAGATGCC     40800
     GACACCCGAT TGCAGGACGG CGGTTTCCTC GCAGGCGATG GCCTGCTCCT GAAACTCCTG     40860
     CACAATGGCG CCGGCGTGAA CCGCTTCCTG CGTAAACAGA TAGGCTGTCC CCATCAGTAC     40920
     GCCGATCTTC ATTCTGCGCT CGCTGAGCGG TGCTGCCATG ACCGACACCA TGGCGGCCGA     40980
     CATGGCATTA TGTATGCCGC CCGCGAACAA GACCTGGACG GATTCAGGAT CCTTGATCTC     41040
     GGCATTGAGC AAAGTGTCGA TCGCTGAGCC CCACAGGGTA AAACTTGTGC GCGGGCCGGT     41100
     GTGACCGCCA CATTCGCTTC CCTCGAAGAT GAATTTCCGT GCTCCTTCCT TGAGAAATTC     41160
     CTTCAGGAGG CCCGGAGAAG GCACGTGCAG ATAAGTGGAA ATGTTGAGAT CTTCCAATTC     41220
     CCGCGCCTGG CTCGGCCTGC CGCCGGCAAT AATGGCAAAG GGAGGTTTGA CCTCGCGGAC     41280
     AGCTTCCATC TGCTCTTGCC GCAGATCGAG TGGCATGAAG CCCAATATGC CCACGCCCCA     41340
     GGAACGCTGG CCCATCAGCT CCTTCGCCTT GACCAGCAGC GCGCGCGCTT GGGGGCCGCG     41400
     CATCACCGCG AGGGCGAGAA AGGGCAAGCC GCCTGCTTCG GCCACGGCCT TGGCGAAGGG     41460
     GGCAACATCA CTCACCCGGG TCATGGGCCC TTGCACGATG GGGTAGCGGG TCCCATGCAG     41520
     CTTGGCCAAG GGGGAATCGG GTGCCAGGTG ATTGTTGCTT CCGGCCTGGC TCAGGGACGC     41580
     ATCAATGGCG TTGCGCATCG CCATGATGAC ACTGCCGACC GTCACATAGC GCTGGCCGAA     41640
     GGCGCCAGCA AAAGCGATGT CCTGTCCGAC GGGCATGAGG GGATCGATGT GATCGGAGAG     41700
     CTGCCGTTGC AGGAGTTCCT GCCAGCCGGC GCCTTTCGCA ACAGCCAGTT CGAGTTCGCG     41760
     CAACTTGCCG CGCCCATGCC GATTGGACAG ACGAAACAGA TCGGCATCGC GTCCAATCGT     41820
     GAGCGTTTCG CTGCCATCGA GCCGGCTCCA GAGCTCCCTT TGCCCGGGGG AGAAACAGGG     41880
     GCCTTCCTGC GTCAGCCAAA GTTGTTCGGC AAGGACCACC CCAGTGGCGC CGGCTAGAAC     41940
     CGCCGCAGCG GCACTATGCA TGCTAATTCC GCCCTGTATC CAGTAAGGAA TCTTGATTGG     42000
     CCCGCGCAAT TCCTGCAGCA AGATGAAAGA GGACGATTTG CCGACTTGGC CCCCGGCCTC     42060
     ATGACCTTTT ACAATCAGGC CCGCATAGCC CGCGGCCTGC GCCGCCAGAG CCGTATCCTG     42120
     ATCATGAACC TCCAAGAAAA CCTGTTGCGC CAAGCGCTCG GCTGCCTTGA GTTGCTTCAG     42180
     CACCTCATGG GTCTTAAGCC CTGCGAGTAC TAGGACTGGT ATCTCGCCCT GGAGGTTGTT     42240
     CGCGAGCTGG TCCAAGCCGC GAGAATCTGC CCCAAATGTA TCCCACCGTA CTCCCCAACG     42300
     CCCAACTGCA CCGGTCATGC TGCGTAATTG ATGGAGTGCC GCAGTGATCG CGGCGGCGTC     42360
     ATCCTGTAAT CCCAGATCGA GAATACCAAG TTCGCCTGCC TTGCTGGCTG CAATGGCTAT     42420
     TTGTGGATCG ATTGTATGCC AAGGTGTAAT AGCAACAATG GTTTCCATTC GTGTACTCCC     42480
     TGAGGACGCA CGCCCACAGC GTCAGTTCAG GTGAACTGAC TGCGCGATGA AGGCAGCGTC     42540
     ATCTTTGCCC GCTAGCGGTT TTTGGGTCTT GGGTTTTCGT ATTTTGTGAT TTTCGGCTTC     42600
     ATGATATCGA GCCGGAATTT CAGCTGATTT TGTTGATCAG CTTTGCGCTG ATGTCCACGA     42660
     CGCACGGGGA TAAACTAAAA CATAACAAAT AATTACGATC CAAAGGGAGC GCGTCTATGA     42720
     ATGTCGAATG CGCTCTATTC CACTGTGGGC GTATATGCGA CTAAATGTCG CATCTCCTTA     42780
     TTGATACGCT AGGTTCCAGG TGAGATCAAG GGCTTTCTCA GTATCAGCAA TGTATTCATC     42840
     GGGTTTGGAC CGCAAAAATG ATGCGGAGTG CTGTGGTATA GTGCCTACCA CGGGGATAAT     42900
     GGATACTCTC TCAGATGCGC GATGGTAGAT AAAACAGCGA TGTATCCAGT ATTGGTAATG     42960
     GCGTAGGTAT AGTCATAGTA ATTGTAGCGC CCAGGCTCGA AGGCGGGCCA GGGTGAAGAT     43020
     GACAAGTATC ACAGTGCCCA ATCCCCATTA TCGTCATCGG TTCCCTGGAC AGATGACAAA     43080
     TGATCCTGCG ACGAGAGTTT CACCCGGATT TAGAGTGAAC TCCATTATCC ATGCACGCAG     43140
     CGATCAATGC GGTGCCATGC TCGATGTCAC TTCTGAATGA TGACATCAAA ATCTGCCAAA     43200
     ATGCAGAGGC GATTTGTGAA GTGGCCTGGC GCCCGGCCGT GTATTTTATA GTAGCTTTAA     43260
     AGAGATGCAA CACATTCATG GTCTTCCAGA AACGGTTGTA AACTCTGCCG ATGAGCAAGA     43320
     TTGGATTTGC GTCGCTTGCA GTATCAAATC TGAAAGTAGA TTCCCCTTTT TAGGGATTAA     43380
     TATAACGTAT TTTCAATAAG ATAATAGTAT TAGATAAGAC TTAACTTGAA TGTCTGATGC     43440
     TCTGAAGCAG AGGGACGAAG TTCTCCACGA GCGATATGAA CGTCACGTCG CTGGGTCGCC     43500
     GTGATGCGGC CCCTTATTGT GCTCATGATC GTGGCGCATG AATAGCGATT GGCGTCAGTT     43560
     GATCTGTGAA AGCGTAGACC AAGCCGCTGA TCACCGTCAG CATCGATGAC AACGGTGCGT     43620
     TCTTCTTCGC TCAATCGGAA ATCGCGCCGG AGGAACTCGT CACTGTGCTC GGGCCAACTT     43680
     TGTGTGGCCA GGTTCTCTCA CGTGTTAAAA CCTATGTCCT GTATACCCTT ACGAACTGCG     43740
     CGGCCCTTTG GGCTGCGCAG TCCTGGCTTG TCTATGCTCG ACGGCCGTGC GTACTGATCG     43800
     TTTCGTGTGC TTGCCGCAAG GCTCGCGCCA AGCCGTTGCG TTTTCTCGCC ATCTTTCAGG     43860
     ATGGTTGAAG CCTATTCTGC TGCCGCATGA GTTCAAGCTC GTTGCCTGGT GGTCAAGCAG     43920
     ATGCATCCGT GGGTTGGGAG AAGGGCTTGC GGCCATTCCC TTGCCTTCAG CCTTTCCCGC     43980
     AGGACTTTCC GAGCCTGTTT CAGTCGGGTG AAAGCCTCGA ACCTGGCGTT GTTTAAGGCC     44040
     GGCATCTTTG TGCTCCGGGA CAATGCCGAG GGCAAGAGCT ATGGCCAGCG CGGTGCCGAT     44100
     GGCCGCATCT TCATCGCCTA TGGATTCTCT CGCTGCTGGA GCAGCGCTGC GGGGACTTTA     44160
     TCTCTCGACC AAGCCTGAGG ATTATTTTCC GAGCGGCCCA GTGGCTATTT CGGGGCACTC     44220
     CGCAAAGCCG ATGTTGGAAA AAGATCATCG AGTTATTGAA AACAAACGCG CAATTTATGT     44280
     TAAATTGTCA TTGAATAAAC TGTTTTTCTG GTTACAGGAA GCAGGATGGC TTGTGGAGCC     44340
     GTTGACTTGA GAAAGAGAAG AAAATGACCG TGTCCTCAAT CGACCAGGTC CGATCCGAAA     44400
     TTGCCTCCCT CGAAGAGCGC TTGGAGAAAC TGCGTCAGGT GGAGAGCATC CTTGCCGAAC     44460
     TTTCTGGTGA AGGGGTAAGC CAACCGAGCC CGAGAAAGTC CCGTGTCTCA GCTCGGCAAC     44520
     AGATGGAGCG GCGGCCGGAA AAATTGACGC AGCCTGTGGG CCGCCGTCGT GGAGCTAAAC     44580
     TGCAAGGGCG TGAAGGCTCG ACGCCCAACG CCATTCTCTC TCTGTTGGAG ACGCAAGGTC     44640
     CCCTGGCACG TGCGGAGATT GAAGAAGCGA TCCGCGCCGA GCGTGAGATC GGCAAACAGA     44700
     CGGTTTCCGT GAGTCTTCAG CGCCTGCGCG GGAGCGGTAA GATCCAGCTC GAGGATGGCA     44760
     AATGGGGTCT CGCTGCTTGA GCAGATGAAG TGAATGGCTA GAGCATTCGT CGTGGCATGC     44820
     CCGACTTGGA AGCAATCACT GAACTGAATG GCAAATTGCC CTCTGCTGCC CTCCCGTCAA     44880
     GTTGTGCTTG ACGGGAGCCC TTGGCTAGCT TCACCCATTA CAGCCATCCA TTCACCCTCG     44940
     CGGCACTATC TCGAGCCAGC GCTTTTTTAT GGCGAGATAT ACAAGCTCCG GCTTCGTCAT     45000
     TCGGAAAGCT GCTTCTGTAT GTTGCTTGAT TGCTCTGTAT AAACACATTG GCTCCATTGC     45060
     GCGAGATCGA CGATAGAAAC GCGCTGGCCT CTTCGCCTTT GTTCAACTGA CGTAAGGGCG     45120
     AAGGTGTGGC CTCTGTACAT GACAACGATA GAAATCGGCA AACGATATCT GTCCTGTATA     45180
     AAGCTTAAGC TTACGCTTTT CCGGCGTCGC TTTGTGTGCG TCCGAAGACC GGACGGATAA     45240
     ACCGTAGAAT GAACCGGAAT CCGAACGGTT GTTTCTGTAA TGAACTTATA AAAATTTAAA     45300
     ATTATCAAAT AAAAACATAT TATTATTGAT TTTATAGTGC GCCCTAAATG TGTGGCATGT     45360
     TCTCTGCGCT ATCGAAAAAG TGGTCATTCG TGAACTTGAG AGAATGAACA CCGCAAAGAA     45420
     GTACATGTCT TAAAAGTCAT AGACACATTA AGGGAGCGAA AATGACTCAT TCGGCGACGA     45480
     TGGAAAAGGT GGAAAACGGC TCGTCAGAAC GGCTTACGCT TGATGCGATT GTCATTGGTG     45540
     CCGGCGTAGC AGGTCTTTAT CAGCTCTATC GCTTGCGCGA ACAGGGCCTG AAGGTCAAAG     45600
     TGTTCGAGAC CGCGTCGAAT GTCGGCGGAA CCTGGTATTG GAATCGCTAT CCGGGGGCAC     45660
     GTTTCGATTC CGAAGCCTAT ATCTATCAGT ATTTCTTCTC CGAGGACCTT TATAAGGGCT     45720
     GGAGTTGGAG CGAGCGCTTT CCCGCACAGC CTGAAATCGA GCGCTGGTTG AATTACGTTG     45780
     CCGACCGATG CGATCTGCGC AAGGATGTCT ATTTCAACAC GACGATCAAG AGTGCCCATT     45840
     TCAATGAGGG CACAGAGCGA TGGATCCTTG AAACTGACGC AGGTTTGACG ATTGATGCGC     45900
     AATTTGTGAT TACTTGCTGC GGCATGCTCT CTGCGCCCCT CACATCGACC TTTGCCGGAC     45960
     AGGATACATT CAAAGGACAG CTCTTTCATA CCGCGCGGTG GCCTAAAGAG CCGGTCGATT     46020
     TCTCCGGCAA ACGTGTCGGG ATCATCGGTA ATGGTGCGAC CGGCATCCAG GTCATCCAGA     46080
     CCATCGCTGA TAAAGTTGGC CATCTGAAGG TGTTCATGCG CACCCCGCAA TATATCATTG     46140
     CGATGCGGAA TCCGAAATAT GGCAACGAGG AAGTAGCGGC CTACAAGGAC AGATTCCACG     46200
     AACTGGCGAA GACCCTACCG CATACATTCA GCGGCTTCGA ATATAGTTTC GAGAATGGCG     46260
     CATGGGCGGA TTTGCTGCCT GAGCAACGCC GGGAAATCCT TGAGACGATC TGGAATGATG     46320
     GCTCGTTGAA ACTATGGTTA GCGTCGTTTT CCGAGCTGTT CTACGATCAA AGCGTTTGTG     46380
     ATGAAATCTC GGAATTCGTC CGCGAAAAGA TGCGGGAGCG GATCACCGAT CCAAAGCTTC     46440
     GTGATCTGCT GATTCCGAGC GATTACGGTT TTGGCACGCA TCGCGTTCCG TTGGAAACCA     46500
     ATTATCTTGA AGCCTATCTG CAGCCCAATG TTGAAATTGT CAGCGTCAAA AACAATCCCA     46560
     TTGAATGCGT CACCCCGGAA GGGATCAAAA CTGCCGATGG TACTGTCCAC GCACTCGATA     46620
     TTATTATCCT GGCCACGGGC TTCGACGCAG GCTCCGGTGC ACTGACGCGC ATCGATATTC     46680
     GTGGACGCGG AGCAAGATCT CTGAAAGAGG ATTGGAGCCG CGACATCCGA ACGAATATGG     46740
     GGCTACAGAT ATACGGATAC CCAAATCTCT TCACGACTGG AGCACCTCTT GCTCCCTCCG     46800
     CGGCTCTCTG CAACATGACG ACATGCTTGC AACAGCAAGT CGACTGGATC AGCAATTGCA     46860
     TTAAATATCT ACATGATAAT AATCTGAAGG TCATTGAAAC AACCAAGGAA GCCGAGGATC     46920
     AATGGGTAAA GCACCATGAC GATATTGCTA ACAAGACGTT AATGACCAAG ACGAATTCTT     46980
     GGTACATGGG CTCGAATGTC GAAGGAAAGC CGCGTCGGCT TCTCTCTTAC ATTGGCGGGG     47040
     TTGGGGCATA TCGGCAGAAA TGCGATGAGG TAGCGGCGGA GGCCTATCGT GGCTTCATCA     47100
     TGAGCTGACG GCAGCAAGTA TTCGGCCCAT TGAGAAAGGC GCTTCGAGGC GGAAAGTCGC     47160
     GGAGCGCTCC ATAATCAATC AAAGAGGGAG GATGGCCATG CTTGCAGAAT TGAAAACTTC     47220
     GGCCGACGTT ATCCTTGATA ACGCCGTCAC ATCGCAGCCA AGTGTTGCTG GTGTCGTGGC     47280
     GATGATCACG GATCGCCACC ATACCATTTA TGAGGGTGCG GCTGGTAAAC GGCGTCTCGA     47340
     CAGGGATGCC GGCATGACGT CAGATAGCGT CTTCGCGTTA TTTTCCACCA CCAAGGCGAT     47400
     TACCGCTACA GCCGTGCTGC AACTTGTTGA GGAGGGTAGG CTCGACCTCG ATGCGCCCGC     47460
     CAGCCATTAT AGCCCAGATA TCGGCAAGCT TCAGGTCATC GAGGGCTTTG AGGAGACAGG     47520
     TGCGCCGAAA CTGCGCGCAC CCAAACGATC GATAACCACA CGCATGTTGA TGCTGCACAC     47580
     TGGTGGATTC GGTTACGATT TCTTCAATGA GACTTATAAT CGTCTTGCCA GGGAAAGGGG     47640
     CCAACCGAGC GTCGTCACCG CTTCGAAAGC AGCACTTATG ACTCCGCTGC TATTCGATCC     47700
     TGGCGAAAGA TGGGAGTATG GAACCAATAT CGATTGGTGT GGCCAGATCG TTGAAGGCAT     47760
     CACAGGGAAG CGACTTGGGC AGGTCTTCAA GGAGCGTATC TTCGATCCGC TGGGGATGCA     47820
     GAATTCGACT TTTGAACTCA CCGATGCGAT GCGCAGTAAG CTGGCCATCG TGCACGCGCG     47880
     CAATAGCGAT GGCTCGTTGA CGCCGATGGA CTTCGAGCTG CCGCCGCAAC CGGAAGTGCA     47940
     TATGGGGGGA CATGGTCTCT ATGGCACGGT TGGCGATTAC ATGCGTTTCA TCCGCATGTG     48000
     GCTCAATGAT GGTGCAGGTG AGCATGGGCG TGTACTGAAG GCCGAGACAG TCCGGATGGC     48060
     CGAAAAGAAC CATCTGGGGG ATAAGAAAAT ATCGCCACTT CCTGGTGTCA TCCCTGCACT     48120
     TTCCAATGAC GCGGAGTTCT TTCCAGGCGC ACCGAAATCA TGGTCCTTTA GCTTCATGGT     48180
     AAACGATGAA GAGGCGCCAA CAGGGCGACC AGCCGGTGCG CTAGGCTGGG CGGGACTGGC     48240
     CAATCTTTTT TACTGGATAG ATCGCAAGAA TGGTTTTGGA GGGTTCTGGG CAACGCAGAT     48300
     CTTGCCCTTC GCCGATCCAG TCTCCTTCTC TGCCTATCTC GACTTCGAAA GCGCCTTCTA     48360
     CGCCAGCCTC AAGCAGCGCA ATGTCGCATG ACACAAGAGG GCTCGCTGGG ATAATTGACT     48420
     CAGCAAGCCT TAGAGCATGT TTGGAAGTTT TGATCCACCC CCACATAAAA AACATACTAA     48480
     ATCTCATGGA TCATGACTTG TCATGATCCA TGAGAGACGG CGGTCAAGTC TTGCTGAGTC     48540
     AGACTCAGTA AGGCTTTATA TTACCGCTGG AAGCGCGGAG ATCATGCGCG ATATTTTCAA     48600
     GCTGAAAGAT CTTCATCTTC ACGTAAAGAG TGCTTTTGGC AATTCCCAAC TCGCGGGCGA     48660
     CAGCTGTCAT ATTGCCGTGA TGGGTGCGAA GCATTCGGAC AATGGTTTCA CGCTCCGCAT     48720
     TCTCGATCGG TGTCAGTGCC GATGAGGAGG TGTCCGAATT TCCTGTTGAC GGTAGCTTAT     48780
     TTGTCAACGC TGAAAACTCG GGCGGCAGGT CGGCTTTCGT CAAAGTCTCG TTTGCCGATG     48840
     TCAAGAGTAT ACCTTCAATC ACATTCCGCA GCTCCCGGAT ATTGCCAGGC CAATCGTGTT     48900
     GCTGCAACGC ATTCATGATA TCGGCTGAAA TATGGCGAGA AGGGAGGCCA TATTGTTTCG     48960
     TAAACAAGGC CGTGAAATGT TCCGCGAGAA GCGGAATGTC TTCAGACCTT TCACGTAATG     49020
     GGGGAATGGT GATGCTGATG ACCGAAAGCC TGTAATAGAG ATCCATACGG AAACGGCTGG     49080
     CTTGCGTCTC CATACGCAGG TCGCGATTGG TCGCGGCAAC AAGCCGGAAA TTCACCTTCC     49140
     GCGGCTGTAC TTCGCCGATG CGACATATTT CCCGCTCCTC TAATACACGC AGAAAAAGGG     49200
     GCTGAAGGTC GGTTGGCAAT TCTCCGATCT CATCGAGAAA CAAAGTGCCG CCATTTGCGG     49260
     CTTCGATTTT TCCCATCATG CCGCCTCGGC GCGCCCCGGT AAAGGAGCCC TCTGCATAGC     49320
     CAAACAACTC ACTGGTCAGC AGATCGCGAG AAAGGCCACC GCAATTGAGC GCGATGAAAG     49380
     GCCCTTTGCC GACTGCTGAA GCTTCATGCA GATCGCGCGC AAAGACTTCC TTGCCGACCC     49440
     CGGTCTCGCC TAATAGAAGG ACCGGCACAC TGCTTTTGGC GATCTGACGC GCTCGTGCGG     49500
     CCGCCAGAAG CAGAGCTGGT GCTTGTCCAA CGAGTTTTGG GAAGATACGC GTCCGTTCGG     49560
     GCTCGGAAGG TGGAAGAGCA ATGCGTGTGC TGGCACGAGC GAGCTTAGCC GATGCTCCTT     49620
     GACGGTTGGG AATTGTCAGA ATGACTCCCA GACGCTTGCC GCCAGCGTTC ATTGGCGTCA     49680
     ACCATTCCTT TTGTATCCAC GGCGGCAAAT GTTCTGGGAG ATCGTGTCCT CGTCTCCAAT     49740
     CAAGTGTGAG AGAGAACAGA TTATTCCTCG TCAGGGATTG TGGTGCGCCG AGATCAGCCA     49800
     ACATAACCGC TGCATGCGTA TTGGCTTTGA TCGCGCGGCC ATGCCGGTCC AAGACGACTA     49860
     TGCCATCTGT GGAATGAGCT GTGAGACGAT CCATGCAGCC CTCGAGGAGG CGATAGCGAA     49920
     GATCCATTTC CATCTGCGCG ATACGGCTTT CGATGCGGCC AGCCGTTGCC ACGACGAGTG     49980
     CGAGACTATG TCGGCTGTAA GAATGGCTGA GGCCGGATAC GTCGATCACA CCGAGGGTTG     50040
     ATCCATCGCA AGGATTTTTT ATGATACTTG CAGAGCACGA CCAACGCTTG ATCCCAGAAC     50100
     AATAATGTTC GTTGGAGTGA ATCTGGATTG GCCTGCCGAT CTCAATCGCG GTGCCTATTG     50160
     CGTTGGTACC GCATGTGAAC TCGCTCCAGT TCGCACCGGG CAGAAGATGC ACATTCTCCG     50220
     CGGCCCCGCG CAAGGATACA TCGCCTTCCT GGCTGAGGAT CAGGCCTGTG GAATTCGTGA     50280
     GGACCATGAC GGTCGATGTT TCACCGAGAA AGTCTCGAGC CGAGGCCATG ACCGGTGCGC     50340
     TGGCCTCGAT CAGTTCGGCG CATTCATCGC GCAAAGCATG AAGGGTATCC TGCTTGACCG     50400
     GTGGCGGTGC TTGATTTCGC CGATGGTCAA TGTCAGCGTC GTGGCAGCGG CGCCAAGATT     50460
     GATCGATAAG ATCGCGCAGG CTGCTGGTTG CCGAAACGTC CCCGTTCATG AAACGTTCCC     50520
     AGGACGCCAT GATATCGGGG TCTTTCTCGG GCACGGAGAA AGTCTGGTTC ATGGCTGTTC     50580
     TGCTCATGCG TTTCCTCCTT TACTGAATGC GACGCATGGC CCGCCGTGTG TTTCTCTTTT     50640
     GGGCATGTCT GTCGCCATCA GGGCTCTGCG GCCCCTTGCT GTGTAGTATA ATGCGATCAG     50700
     TAGCAAAATA CTCAGGCGAC ATTTATAGGA GTGGCTTGCT GCTGTCGTGC GAAAAATTGC     50760
     TCCTCGGGGG CAGATTAGGT ATCGGGCACT GTATGTCCCC AAGCTTATTA AGTTCCTTGA     50820
     CACCGAACGC GCCGCCCGTA TCGCCGGCCC AGGCGTTAGA ATAGAGGTCG TCCCCTGCGA     50880
     GCAGAAGAAC AAGGCCTCAA AACTATGGCG GCGATCAGGC CCGTGAAAGT GCCGCCAATC     50940
     CGCGCCATAG GCGCGTCAGG TTATTGGCGG TACGTGCCGT CTTAGCTAGC GGGTGCCTGT     51000
     TCGGTGAGTG CAGCGAGCGA CGCGGGCAGG GCGGGCGCGG CCGACAGCTC TGGAATAGTG     51060
     GAAAGAGGAT TTGCGGCAGG GCAATGGGAT ATGGGTCGAG GGGGAGGCAA TAACATCCGA     51120
     TAATTGAATA TTATCGGATG TTATCTGGCC ATGCTAAGCG CGGCGATTCA TGCGCTTTTT     51180
     ATGGCGAAAA GACGCCGTCT TGGCTTATCA GGCGGTATGC CGCTGCCGTT CGCCCCAAAC     51240
     TGCAGGAGCA CCGCTAGGCA ATGTCGGCGG GGATCATCCC GACGAGGATC AGGCGCACGA     51300
     TCCCCGGCAA CGCCGCGTGG AAGCTAGCAT GTGTCGCATG CGCCGCATGT TTCGCCCCAT     51360
     AAGCCGCGAA CAGCAGCACC TGCGCCACAT CCTGTGCGGA CGAGCCGACT GCGGAGAGCC     51420
     GAAGCTCTCC GCGTTCTTCC GCGGCCTTGA TCATACGCGT CAGCCGACGC CGGAACGCCT     51480
     GCACCGGCTC GTCGACCGGC ACGGAGATCT CATGGAGAGC GACCGACTTC AGTTCTTCGA     51540
     TATGCGCGGT ATTCTCGAAC CATTCGATAG TCGTGCCGTA GACCGCGTCG ATCAGGGCCA     51600
     CGATCTTGTT CTCGACGGAC GTCTCGATCG CCTCCGCCGC GGCGCAGCGT TCCTCCTGCA     51660
     AAAGCTGGAA CCGCCGGATC ATCTCCCTGA ACATCTCCTC CTTCCCCGAG AAGTGCAGGT     51720
     AGAGGGTCGC CTTGGCGACC CCCGCCTCGC GCGCAATGTC GTCCACGGAC GTGCGGCGAT     51780
     AGCCGTAACG GACGAACAGC GAACGGGTCG CGGCGATGAT CTGATCGGCC TTGGAGCCGG     51840
     ACGCAGTGAC GGATGCGATG GTAGCCATGC TGCGATCATA GCATAAAACC ATATAGACTA     51900
     AAATGACCTA ATCGGTATAT TTGGTATATC CACACTCTTC ACTCCAGGAG AAAGCGTCAT     51960
     GGCTCGCTTC ACCGGCAAAT CGGTCGTCAT CACCGGCGGC TCCAGCGGCA TCGGCCTTGC     52020
     CACCGCCCAG CGCATCGTGG TGGAGGGCGG GCAGGCGCTC GTCACCGGCA CCAACGCGCA     52080
     GAAGCTGGCG GCCGCGCGCA GCGATTCCAT CCACGTACTG GAGAATGACG CGGCTAACCC     52140
     CGCCGCCGCC GCCGCGCTTG CCGCCAGGGC GAAGGAGCTG TTCGGCGAGA TCGATGGCGC     52200
     ATTCCTCAAC GCCGGCATCG GCAAGGGCGC GGCCCTGGGC ACGATCACCG CCGAGTTCTA     52260
     TCACGCGCTG ATGGACCTCA ATGTGGGCGG CGTGATCTTC GGCGCGCAGG CGCTGGCGCC     52320
     GCTGATCCGT CCGGGCGGCT CGATCCTGGT CACGGCGTCG GCCGCCAAAG ACAAGGGCAT     52380
     TCCGCAGGGC GCGATCTATT CCGCGACCAA GGGCGCGGAA TAGATCGCTG GTGCGCGGAC     52440
     TGGCGCCGCA GGGCATCCGG GTGAACAGCG TCAGCCCCGG CCCGATCGAA ACGCCCTTCT     52500
     TCGAGAGGAT CGGCTTTCCC AAGGAGATGC TGGACATCGT CATCGAGCAT GCCGTGCAGA     52560
     GTAATCCGCT CGGACGCATG GGCAAGGTGG AGGAGCCCGC CGCCGTCGCC GCCTTCCTGC     52620
     TGTCCAGCGA GGCAAGCTTC GTCACCGGCG CCGACTATGC CGTCGATGGC GGCGAAGCGC     52680
     AGCTCTGACC GGGCGGCGGC GCGTCGCGCC TACGAAGGAG GAACGCATGA CCGATCGCAT     52740
     CGACGCCCTT GGCTTCGGCA GGCGCAGCAC TGCGGAGCAG GTGACCGAGG GCGTGGACCT     52800
     GTCGGGCCGC ACGATCCTGC TGACGGGATG CAATTCGGGC ATCGGGATGG AAACAATGCG     52860
     GGTCCTGGCC GCGCGCAGCG CCCGCATCGT CGCCGTCGCT CGGAATGAAG AGAAGGCGCG     52920
     CGGGGCGCTG GCGAGCGCCG GCGCGGCCGA TGGCCTCGCG ATCGGCGCGG AATTCACCGA     52980
     TCTCGCCAGC GTGGCCCGCG CCGCCGATCA GGTTTTGGCG AGCGGCGTCG TGCTCGACAC     53040
     CATCATCACC AACGCCGCGA TCATGGCGCT GCCGAAGCTG GAGACGGTGA ACGGCATCGA     53100
     GAAGCAGTTC CTGGTCAACC ATGTCGCGCA CCATCTGCTG GTGACGCGCC TGCTTCCCGC     53160
     GATCCGGCGC TCTTCCGCCG GCCGGATCGT GGTGGTGGCC AGCAACTCTC ATAATTTCGC     53220
     GCCGCGTGGA AAAGGCATAG ACTTCGACAA TCTCGACGGC GGCAAGAGCT ATGGCGGCTT     53280
     TCGCTTCTAC GGGCAGGCGA AGCTGGCCAA CATCCTGTTC GCCAACGAGC TGTCGCGGCG     53340
     TCTGGCGAAT GACGGGATCA CTGCGAACGC GCTTCATCCC GGGCTGATCG GTGCGACAGG     53400
     CCTGCACCGC CACATGAGAG GGCCGATCGA CTGGGCCGTC TCCATCGCCA TGATGTTCGG     53460
     CAAGACCGTG CCACAGGGCG CGGCGACGAC CTGCCTGCTG GCTGCACATC CGGCGCTCGA     53520
     GGGTATTTCC GGCCGCTATT TCGCTGACTG TCGCGCCGCG AAATCCTCCG CATTTGCTCG     53580
     GGACGCCGGC CTCGCACGAC GGCTCTGGGG CCGGACCGAG GAGATCATCG CATCGTTCGG     53640
     GGTGGCCTGA AAAGGAGCTG TTGCACAATT TTATGGTTAA CGGCGTGTTG AGGAAATAGG     53700
     TGGATTTTGT GCCTCCGATT TGGGAGGCCA GCCATGATCC TCAACGCCAT TGTCGAGAAG     53760
     CTGAAGCGTT CGTCCAAGGA CGATTTCAAG GGGCGGCATT TCGAGGCGTG GCTGATTATC     53820
     CAGGCGGTGT CCTGGTATCT GCGCTATCCC TTGAGCTACC GGAACATCAA AGACATGTTC     53880
     CTTGAACGCG GCTTCGAGGT CGACCATAGC ACCTTGAATC GTTGGTTTTG GCCTATGCGC     53940
     CGCTAATCGA GACGCGGCTG CGATCCTTCC GCAAGCCGCA TTGCGGCTCG ATCCGCATCG     54000
     ATGAGACTTA TGTGAAGATC AAAGGTCAAT GGCGCTATCT TTATCGGGCC ATCGACAAGC     54060
     ACGGCAACCA AGTCGATTTC CTTTTGACGG CGCAGCGTGA TTTGGCCGCC GCCAAGCGGT     54120
     TCTTCCGCAA GATGCTGAAG GACGAGCCTC TGCTTTCCCC CGATCATATC GGCACCGATG     54180
     GTACCAAAAC CTTCCCGCCT GCCATCGAGG CGGCGGAGAA GGAAGGGCTT TTACGCACGA     54240
     ACCCGATCCA TTGGGGCACC AAACACCTGC AACAGGGCAT CGAAAGCGAC CATTTTAGGG     54300
     TCAAACAAAA CATGCCGAAG GTCGGCTGCT TCCAATCCTT TCACACCGCC AGACGAACCA     54360
     TCAAAGGGTT CGAGGCCATG CTGTGGCTGC GCAAGGGCTT TGCTTCATCG GCCAGTCGAC     54420
     TGTCTGCGAG CAGAACAACC TGCTCTCTGT CTGCTTCGGA CTTCCCTTGG TTAACAGAGC     54480
     GTAAAAATCA CAGTCTCAAA CGTCTTGCCG TGTCCGTATA CAAAATTTGC AACGCGCCCC     54540
     TATCTGCGGG GATGCTTTTT CTGGGGGCTT GGACTTGGAC CGATCGCTGC GCTATCCGGC     54600
     CGGAAAAAAT TCTGATTGAC CGGTCTGTCC TCTCTTCCTT CATGCATGAT CAAGGTGCCA     54660
     GGAACACGAC GGGCTTCCGC CGCATCTTCC TGGGCGCGCC CGATAGGAGA AGGTTGGCTA     54720
     TGCGCGCTCA TTAAGCTCGC CACGAGAAGA GAGGACATCA TGAAGAGTAA AAAAATTATT     54780
     GGATATGGCT TTCTGAGAGA CATCTCTCCT CTCCACCTAC GCGTGGCTGG CTTTTGAAGG     54840
     ATCCAAACGA AGCCCCACGA CAAGAGTTCC TGCAAGGCAT GGCCTTCGCC AAAGGGCCCT     54900
     TAGCTCTTTG TCTTCGAACA TCGGGATCAC GCTCGACATG ATGGCCTAGC CTGAGGGAGA     54960
     AGTCTTACAC GGAGTTTCAA GGTCGTGCCA TTTATGCGCA GCTTTTTGAA GCTTCATGCC     55020
     AACAAGCCAA CAAGACTTCG GATCTGTGTC TTCTCCCTAG CCTCAATGCT TATGGTATGG     55080
     ATGTTTCCGC TGGTGGCTTG GTTTCGGATC GATCGCCGCG CTGTCAGGCC AAAAATAATT     55140
     CTGATCGCCA GGAATGGCCG ATCTCCCTTC ACGAATGATC AAAGTGCCAG GAACCTGATA     55200
     AGCTTCCTCT GTCAGTTCCT GGACTTGGCC GATGGGAGAA GGTTGGCTAT GGGCACTCAT     55260
     TGATCCAGCC AGGGATACAG CCATGATACA GATGGACATT AGCAGGAACC AATAGGTCGT     55320
     CTGATGCGGC TCTTTAAGGG ACATCTGACC CTCCAACCCC CGCGATGCTA ACCTCGAATG     55380
     GCCCAAAAAC GGATTGGAGA GGAGAAGGGT TCCCCCCTTC AGGGGATCGG CATGCGCTGA     55440
     AGAGCCGTTG CTCCCCATCT TTGGCTGCCG AGGATCAGGT TTCGCGGATG ACCAGTGCAG     55500
     GAACTCACTG AGGCCCTGAT GCGCTCTCTC GAGAACTGTA TCCGCCTTTT CTCATTGGAC     55560
     AGCGATGTTT CAATGCCAAA GAGAGTGGAT ACTTGAGTGT TGTTCTTCGC ATCAAGCCAA     55620
     AGCGGTATCC GCTTTGGCTT GATAGTTCCT TTATACCCTT TGCAAGAGGG AAGGGCAGGG     55680
     TGGGACGAGA GCGTTCTCAG AAACTGAACT CGACCTGGAA GACGCCGGCA TCTGAACTTT     55740
     TGCCTCCGGA GAGAGTAATG GCAGGGCCAG CGAACGCATG GATATATTCG ACATAAACCT     55800
     GCGTATTTGA GTTCAGGAGC CAGGAGACGC CGCCGATCAT ATTGGTGCCG ATATAGCTCG     55860
     CCTTATTGTT GCGGGTCGCC GTCAAAGGAG TTTGGGCGGG AATATAGACA TAGTCATTGA     55920
     CGGAGGCGCG CCAGTTGAAC TGAGGCCCGA AACGAACCGC AAATTCCTTA GTGGGGTTGA     55980
     GGATAAGCGC GGGAGCGACA TGGATCATGT TTGAATAAGC GTTAAAGCTC GCATAGGTCA     56040
     GCTGTGCTGA ACGCGGGAAC GGCGCCGTGA AAGTGCCGAT CGTGCTGCTC TTATAGCCGT     56100
     TGCTGCCGCT GAAATAGCCG CCCTGGAGTT GGACGATCGG CTGCCATTCC GCCTTTGAGA     56160
     AGGTATAAGT GACGCGCCCC AAGGTACCAA CGGCGCCGAC ACGTGTATGA GCAAATTGAC     56220
     CGAATTTGTA ACCGAAATCG ACATCATAGC GGAAATCGTC CACACGGCCA TAGACGCGGC     56280
     CGGCGACCAT ATCACCCTGT TCGGTGCCGG AGCGGCCGGC CAGTGACACA TTGGGGCGAC     56340
     GCCAATAATA ATAATATTCG TCGACATTCA GCACCTTGTC GATGACAGGT GTTGTAATAT     56400
     ACACGCCGCT GAGTTCCTGC GTATAGGAAC CGTCCTGGAA CGCTGTGGTC GTTGTCACGG     56460
     TTGGCCGGGC CGAGAACATC TGGAGCCGAT ATCCCTTGTC CCAGGTCGCT TGAACGAGGG     56520
     CGCCATCGAC CGCGGTCGTG ATATTGTTCG CATTGCCGTT CCACAGGAAG CGGCCGGAAC     56580
     CAAACAGGAA TTCCTGGCGT CCCAAGCGCG CGGCAATGTC CAGTGGACCG ACTTTCTGGG     56640
     TATAATCGAC GAATAGATTT TGGATGCGCG CCGGCGCGAC ATCATTGGCG CCATAAGGCT     56700
     TGTTGCGGCC GGGGCTAAAG TAGCTGCCCA ATTCCACCAG CATCGAGAGA TGTTGGTCCA     56760
     CATGATACCA GGCAGAGACC GTTATGCGGG AATTTAAAAG CGTATCATTT TTATTTTGGG     56820
     GGCTGGTGGG AAAGCCCTGC CGTAGATTTC GATACCACCA GCCCTGCTCA CGGATCGCGC     56880
     CGCCGAGAGT CAGATAGGAG GTACCGGGGA TGCCGAGCGG AATGTAATGA ATATTGTCCA     56940
     AAAGGGTCTT CCGGTTCGCC GGATCGGCGA GCTTGGAATA GTCCCGATCG GTGAACATGG     57000
     TCGGGTATTC ACCCTGATTG ATCTGAAAAT ATTGCGCCAT CGCTGAGCCA GGCAGCAATG     57060
     CGATCGCGCA AGGAACTGAA TATTTTGCAA CTTTATATGC AAACCCCCGC AGCAGCCTAC     57120
     TCATCTATGA ATCCCCAACA GATAGTTTAT GAAAGTTTTT TGTACCTATA GCTTAGCGAT     57180
     AATCAAGCCA CACAAGCTCA TTGTATCGCA GCGGGGCACT CATAAATGTA CGATGAAGCA     57240
     TAAGCGCAAC ACTATGATGG CAGATAGCCC ATAGTACAAT GGATGCGGCG CGCCAGTTTA     57300
     CGCGCACGTA ATCGACTGAC CTTGCATGAA AGCAGGGTCA GACAGCATCA AGGATGAAAT     57360
     AGGAAACACA TACACTTGGA AAAGGCGTCA CGACTGCGGT GTCAACCCAA GTCGACTCTT     57420
     CCATGACGTC AGCCGAGCAT GGTTGTTTTC CAAGTGGTCA TGATGAACGT ACCGGAAGCA     57480
     AGGAGATCGA CTGCCTGTCC GTCACTCGAT CTGCAGTTCG CCGTTCGCTT TCCCCGCCTT     57540
     GTCGCCACCG CCTCTGTGGG GTCCTCTCGA TACTAAATCC GATCCGTGCC ATCCCGCCCA     57600
     GCGAGACATT CCTTTATAGC ATAGCGATTT TCTATGCTAT GTAAATATAT TTATATGGAA     57660
     ATATTTTCCC ATATAAATGA TATAATTTAT CAACAGCTTA TTGATATCGT AATAGCTTTC     57720
     GCTGTTTAGT CCCATATATT TTAGGCAGCG CCGGCCGGGA CGGCGGTCTC ACGGGACCAA     57780
     AAACGTTTCG AAGCGAAAGG TCTGGAATAT TGCCATGGGA ATAGGGGGAG CTAAAGTCTT     57840
     CGCGATGATC AAATCGGCTG GCATCGACGA AGGCCTTTTT GGTGGTCCGC CCCTTTTGCC     57900
     TGCTTAATGA GAAGGTTCGT TCGATAGCCC AGACAAAATC GGTTAGTCTT TGAGCGCTTA     57960
     GCAGGATGGA GGGCACCATG GCATGAAGGT GTAGGAAGGC GACAAGGCCA AGGTTCCAGA     58020
     AGTGGCGCGA GGCCTGCGTC GCTCTGGGGC TGGCATCCAC ATGGTTATTT TCAGATCAGT     58080
     GTAAGCAACC TATTTCGAGA CAACCTCTTA AGGCCATGAG GCGAGATACT TAAATTGTCT     58140
     AATATAAGGT TTGCTAATCT TGATTGTGCC CCCAGCGGCT GCACCTGATA CAGAGCCGAA     58200
     ACATATTTTT AGAGAACTTA GTTCTATCGT CGAAAAATGA TCAGGAACGG TAAAGACCGG     58260
     TGATAAGAGA TTATAAGTGC CATCCGGCAT GGTATCATTT TTTGTATATG CGGCAGTGGC     58320
     GAACGTTGTC TCTATCGTTG TCACTCCATC AATCTTGAAT GTCATAAAGA ATCCAACAGG     58380
     GACGATATTT TTTCCATTGG CAAGCTCTAT GGTTATCCCC GCGCGATAAG AATTCCCCGG     58440
     GCTTATCCCA GAACTGGCGG CGCTCGCAGT AGGAATAATT GTCCCTGATG TTGACAGATT     58500
     GAGCCAAGTG GCCGCGTTAG AGGAAGGGGC CGATCCATTT GGAACGGTTA TGACGACCTT     58560
     TTTTCGGTAT GCTCCGTCAG GCTCCGTGGT GATTGCCGGC AGAGAGCCCG CAGAGCCGTT     58620
     CCAAGATGCA TTCGCCGTTG CTATCCATCC TGTTGGAACC TTCCCTGTAA AGTTCGTGGC     58680
     CACACCGTCA GCGCCCCCAA ACAGTTGTTT CGCGGAGTTC GGCGTTGCCG CATTTTGAAG     58740
     AAGATTAGTT GGGTCGGCTG CTGCATCAAG TGTGAAGGGA AAGACGACGG GAGCGGGAAG     58800
     CATGTCAATG TGACGGAGCT GTGAAAAGAT GTAATCGGCC ACGCGCAAGG ATCCTGACAC     58860
     ATTCGGATGC ACTCCGTCGA ATGTATAGGC CGGATTAAAA GTCCCGGGAT TTTGCGGATC     58920
     CTGCAGCAGT TCATCGAAAT CAATTGACTT TAGATATTTG TTTGCATGAC TTTGAGAGGA     58980
     GTGCCAAGCG TTGAAGTTCA GTCGGGCTGG ATAAGTTGTC GCGGGATGCG AAAGGTGTGT     59040
     CCGGGGCCAG ATATTCTCAT TTAAAATGCG CGGTGGAGTT GGCGAGATAC TTAAAAGTGC     59100
     GGCCTGTACG GCTTCCGCAT CGGCCTTCAT GCTCTCAAGC GGTCTCCCCA AGTCATTGCT     59160
     GGCCCCTTCG CTAAAAAAGA TGTCGGGATG CCATTTGATG AGCGGGCCCC ATCTACGATC     59220
     CGAGGGTGTC GCGCTGGAGG ATGTATAATT GGTCAGAACC TGCGCCAATG TATTGCCGCC     59280
     TATCGCCCAC GAGCGCGGGG AAGCGTAGTT CCAGCCGAGC AAATTGCTCA ATGGTGTCAA     59340
     ATAGATTCGT GTCCAATATG TATCGGAATA AGTGCCTGTC GAAGTTTGAG CGAATGTATT     59400
     GGTGCTCAAA CTGGTTCCGC CCGCGGCGAC ATTGACGATG CGAGCGAGTG ACCAATGCGT     59460
     TTCTGCGGCG GCATGCGTCG CGGATAAAAG GGTCAAGCCG GCAAAAGCAA GTTTGAAGCG     59520
     GGCGAAACTC ATGGGCAGAA GCTCCAATCT TCCTTGTCGT CAAATGCAAC AATATGAATG     59580
     CTGAGATTTG TTACAAACGT CGTCTGGTTA AGGATTTATT GCGGAATTGA GAACATCCAC     59640
     AGCCTGAAGA CGATAGCCTG GAATTACGGC TGAAGCCGGG TCGAGTGAGT TATGCCACGA     59700
     TCCAACATCG CGCCTGACAT TGTGGCTTTG CGGCGGTTCC ATATTAGGAT GGCATGGAAT     59760
     TCATCATTTA TTTCAAAGTA TTAGTGATAA ATTATTCGTG ACTTTTTGCC AAATTTCTGG     59820
     CGTTATGTCG CCTTATTTTT AATATAGGTA AACTAAAATA ATGATTACAT TTTTGATAAA     59880
     TTAATTTAAT ACCAATATAT GCTTTCTATA TAAATATTGT ATATAATTAC GAACTAAATT     59940
     TTATATATAG TATATTTAAA TAATTTTGTT TATTTGTCTA GATATAATTT TCTTAAATTC     60000
     AATATATTTT TATAGAATTT GCCTAAATAT AATGAATTAT TATATATTTA TTAGCGGCAT     60060
     CAAGCGGCGC TGAAATGATA ATTAGGGCAA TAAGATGAGG CTGTGAGGGG AGCCGTTCTT     60120
     GTTTTTTTAT TAGGGTGATG AAAAATTGAG ATTGGTTGGG AGGGTATTTT ATATTACCAC     60180
     GCATTGCGTG GGAATTCATG TATTCAAAGC CGTTTAAGCG AGACTAGCCC TTTCTAATCC     60240
     AATAGGATAT TCGGGATTTC AGTAAACTGT TGGGCGTCCG CGGCTAAAGG GGTGTTGGCT     60300
     GGTTGAGGGG AAGTTATGAC GCTTGAAGAA ACCATGAATG CCAACAAAGG CATCGGTCCG     60360
     GGCTTTCATC TGTTGCGGCA TGTGCTTGCC GCTTTGATTT TGATTTACCA CTGCACCATT     60420
     GCCGTGTTCG GTGCCCACAC GAACGATTAT ATGGGAAAAG GCTTGCTGCT AGCCCAAAAG     60480
     GCCGGTCATG ACCTCACCAT GCCACAGCTG CTCATGGAAG TTATACGGCC AACATTATAT     60540
     ACGCTCGTGG GCATGTTCTT CGCTTTGAGC GGGTTTCTTG TGACTTCAAG CGCTCTGCGC     60600
     AATGGTAATA TCAAGGTCTT TTTTCTCAAT CGCGCCGTTC GTATCATTCC CGCTTTATCC     60660
     GTGGAAATAA CGCTTTCCGC CCTGATTTTG GGTCCCTTGG TAACCAACCT GCCACTTGGG     60720
     CAATATTTCT CAGATCCACG ATTTTTTCGG TATTTTGGTA ATATAGCGGG CTTTGTGACC     60780
     TTCACGCTGC CAGGCGTTTT CACGGACAAT CCGTGGCCAA ACATCGTTAA CCTGAACCTC     60840
     TGGACCTTAC CGCCAGAGTT TTGGTGTTAT CTCCTCATGC TCGGATTGAT GATCAGCGGT     60900
     CTGCTGTCTA AACAGAAATT ACTGACGGCG GGCATCATCT TTGCCATATT CGTTGCGACA     60960
     GCCCTTGATA TTTTTGATCA TCATACCTTT ACCATTAAGG AAAATAATAC ACGTTTCACG     61020
     GTGTGGTATA TAGTCATGAT GTTTTTTATT GGGATGTTGT TTTGTGTTAA CGCAAAACAT     61080
     GTCATCCTGA ATGTCTGGCT TGCTCTCGGC TGTGCTCTCG GCTTCTACGT CCTGACGCTG     61140
     AGTGATTCCT TTGGCCCCCT AAGTGGATTA TTACTGACCT ATCTGACCGC TTACATCGGA     61200
     ATGATACGTT TTCCTCTGTT CGACCGGATT CTCAAGGAAG ATCTTTCGTA TGGAATTTAT     61260
     TTGTATGGTT TTCCCCTCAC TCAGGTGACG ATCTTCTTCC TGCTACCCCA TCTCGGTTTT     61320
     CTTCCCGGGG GGATACGTTT GGCGATTATA ACGCTGATCA GTTTTTGCCT GACTCTTATT     61380
     TTTGCGAGCC TGTCTTGGAA GTTCATTGAA AAGCCAGCTC TGCGCTTACG CAAATGGGGA     61440
     CAAAAGAAAT CCGTGCCCAT ATCTGCCGAC GAACACGGTC CTGCGCAGAG CGTCCCCGAA     61500
     GGACTAGTGC CTGTTACGGA CGAAACAAGC CTGCGACCAG CGCAGTAAGG AACCAAGGAT     61560
     TTATTATCCG CGATCCTTGG TATTATTTTA AGGTGAGCCG CCACTCATGG CGGCTGTCGA     61620
     TTGTAGCACT TTACCCTATT GCGTTCAGCG GGCCGGTCTT CATTAAGAGT GCCTTCTAGC     61680
     CCTTTTAAGG AAAGAATTTT CAAATCCGCG ATCCGCGAGG CGGGGTTGCG ATGAAGTTCG     61740
     GCCTCGCATA TCCCGCTCTT CCCTCCGTGG CTGCGTTTCT CATGGCATGA TCCGGTTCAT     61800
     GGAAATGTCG AGCGGATTTC CGTTGACGCC TATCACTCAT GATCGCGAGA TAGGTCAAGA     61860
     CAACAATGGG TGCCAACACG CGTGACCCAT ACACAAAATA CCATTGGTTC GGGCTCCAAA     61920
     CAACGCTAGC AATGTCATAA GCGAGTAATG CGGCCCAATA CAGGCTACCT TCACGGGTTT     61980
     TTTGAACCAG AAATGCGGAT ATGACACCCC ATGTGAAGAG AAAAATTCCA CAGCCGATAA     62040
     GACCAAAGTC ATTGACCATG ACGCGAAGCG CTGTCGAGGC GTTTCCATCG CGCCAATCCC     62100
     CAATATCAAT ATTTGACTGA ACCGTATCCA GGTAGCTGCC GCCTCCCGTG ATTAATCCAG     62160
     CCAGGAACTT GAAAGTATTG TTGCCGTATG CGAGATCGCC GCTCCAATAG TTCCAGTACC     62220
     ACCCGTGGAA GGCGGGGATA TAGCCAGCGA ACCATATGCG CATATGCTCC AATGTTTCCC     62280
     CAATTTGCGA AAAATTAAAA TCACCGAGGC GAATGCTTTG GAGAAAAGCC ATCATCGAAA     62340
     CGAGGCCAAA CACGAGAACC GTGGCCGCAA TGGTGTTTCT CTTGGAGAAG ATTGACCTTT     62400
     CGGTTCCTAA AAGCGTCTGT CCCGCTATGA TCCCAGATAC AAGAAGCAAC AAGGACATGA     62460
     AGACGGGACT GCGGATCGTG CTCACGAATG TCAGGACGAA AAGGGGAAAC AAGGAGACGA     62520
     TGACGAGAAT GGCGCGCCGC ATCCATTGAT AGCGCCCGAT CACCGAGCAG ACGCCGACAA     62580
     GAACGATCGC GGCTTGCGGC ATCGCGAAGG CAATCTTACC GAGCATACCC GACTCGATGC     62640
     CGCCCGTTCT GATTTCCGAG TTGATGTCTC TGATTGTCTC CGCATAATCA TCGTTGAGCA     62700
     GGTCGCCTGC GCCGCCCTTC AAAATTTCAT AGGGAGACCA CAATCCAGCG AGCGCGCAAA     62760
     GGGAAACGAA GGCTGAAATG TTGGGAGTGG GGGGTGTTTC CCGGCTGACA GGTCGGCATT     62820
     CACGCATAAG AGTCAGGATC TTGTGGCCCG CCATGAACGA CAAGATAAGC TCAATGATGA     62880
     TAATATTCGT TAGGGTACTC TGGATAAACG GTCCACCAAG CAGGCCGTTT AGCGTAAAAA     62940
     GAGCTCCCCA AACGAGTACC CATAAGGTAT AATCGATATA AAAATCCACA CCTCGGCATG     63000
     AATTTATGAT ATAAATTCCA TATGCTACCA AGAAAAGCCC TGGTATAACG GAAGAGATGA     63060
     CCATTATTTT GACTCTGGCT TCGATGAGCT GCGGGTAATT CGTGGATTAT TCTTCGTTAT     63120
     CGCCATCCAG TGGCGATGCT TTCGTCCGAA GCGATATCAC ACCATCCATG GCGGAAATAT     63180
     GCCACGTGCC GATTATGGAG CAGATTTTCG GCATTGTCGC GTTTGCCCAT TTTACTTGTC     63240
     AAGAGATGGG ACATCACACT CCGGCATCAA ACCAAATGGA CGGATGAAGG ACGCTGTATC     63300
     GATCGCCATG CGTTTTCGAT CGGCTGAATG GCCCCGAGCG GTGCCGTTCT ATCCCGTCCC     63360
     TTGAACGGGC TTGCTCCGAG CATCAGGCAA CGTCTCGATA ATACGCTCGG CGGCGGCGGA     63420
     CCAGGATAGA TGATCATGGA CCCAGCGCTC CGCCGCCTCA CCTAACTTCG TTCTAAGCGC     63480
     GGGATTATCG ATAAGGAGTT TAATCGCCTT GGCGATTTCT GTGTCCTTGG TTCCGTCGAC     63540
     AAGGAGTCCA GTCGCACCAT CGATCACGAA ATCGGCCGGA CCGCCATCAC GCCCAGCCAC     63600
     CACCGCGGCA CCAAAGCTCA TCGCATCGGC GATCGTGAGC CCGAAGCCTT CGACATCACC     63660
     CGATAGGTCG ATTTGCGGGT GCAGGAAGAT ATCCGCGGCG TGATAGAGTG CCGGCATGTC     63720
     CGCATCATCG ACACGGCCGA GCAGGCGGAC ATAAGGCTTG AGGCCTCGCT TATTGATCAG     63780
     CGCCTGAATC GCATCATAGT CTGGCCCGTT CCCCGCGATT TCATAGATGA ATCCATTCAT     63840
     GCCGCTCTCG ACAAGCAGGG CCATGGCGCG TACCGCGCCC AAAATATTCT TGCGTGGCAC     63900
     CAACCGGCAA AGAGAGAGCA GTCGGACCGG CGCACCGGCC ATAACTGGGG GATGCGGTGT     63960
     AAAGCCATGA TCATTGTTGA GGGAAACGCC ATTCCACACG ACGGTCCAAT TATCCGTGAT     64020
     GAGGTTTGCT TGCGAGGCAG CGAGGCGGCG GATCACGTCG CTGACGACCA CGACGCTGTC     64080
     CACGCGTGCG AAGACATAGC GCATCACTAT GCGCAAGAGA GGGGAAACAA TGAAAATCTC     64140
     ACGGCCATGG ACGGTAACGA CGAGAGGCTG TTGCCGCCTA TTCAGCAAGG CTGGCAATGC     64200
     AAGCCGCCAC GTCGTGGCAT GGATGAAATC AGGCCGCAGT CGCTTGCGGA GCACGCGCCA     64260
     GGCACAGGTA AAACGCAAGA GCAGCATAGC CTGCTGGCCT TTGCCAAAAT CCAGGACGGT     64320
     GACCGCGCCA TCGCGCCGGA TTCCGGGCTC AGCGCTACTT TGCGTGAGCA CGTAGAGACG     64380
     CCAGCCTTGC TTGGCATAGG CGCGTGCCAA TTCTGTACTA TAGCGTTCAA TCCCCCCATC     64440
     GGTGGGCAGA TAGCCTTTCG CGAACATCAC CAGCCGCTTA CGCGAGTCCA TGGGAAATTC     64500
     CCTTTCGAGA AATAGCGTTT GCCGCCACTC GGTAAAAAGA TAAAATATTC TCGACAATTT     64560
     CTTCGGTCGC TCTACTGCAT TGGGTGCGAT AGAGAAGAAT AGAAGGGAGT GGAGTTGATT     64620
     TACTTTTTGA TTGAATAACT TAGAATATAA AAGTTGTATA ACTCATCCGC TTGACAAGAA     64680
     AAATTAATAA CAGCTCTCGT TGTCAATAGC ATCCAATAAA TCCGGGGCGA TCACCTATAT     64740
     CAACATTGGA TGATGAATTC AGCTGGTTCC ACAGGCATGC CTATTCGCAT CGACAAAGTT     64800
     TTGGGCTTGC CCCACCCTTA GAATTCGATG AGCCTACTGA AAGTCCCCTG CCCTGACGCA     64860
     AGACATAGAC CGCGAGGCTG CGTGGCGCCA TTGCTGCGGT ATTCCCTGCA CGTTTTACGA     64920
     TCACGCGATC ATGAACGATC CCGCCTGGCC GAGCATCTTG GATTTGGGGA CAAGGCCTAT     64980
     ATCGATGGCA TTAGGACACA ATTCAGGACA GATGGTATAA GAAAATGCGA GCACTTCCCA     65040
     GCTTTCATCG ATCGGGCATT TATGCTGCGC GAGGCCTGGT GGATCATCAT TATTGATATG     65100
     ACAAACCACT GAAATGGAAA GAGTCCGTGG ACGATACTTC CAAAATTTCA AGCGGAATTT     65160
     CAAGGCGCCA TTTGTTCGGC ATGACGGCGG GTTTGCTCGT AACATCGCAG AGAGCCCTCG     65220
     CGGAGACGCC AAAGCCGCTT CGGATCAGTG AATTCGTGAC GGCCCATGCT GACGATACAA     65280
     ATCCAGTCCT CCATAGAGCG GCGGAAGAAG CCGTTGCCCG GAACACCCCC CTTTATATCG     65340
     ATCAGCCTGT CACCTTCCAG CTCAGGTGGA CACCTCCGAA GGGCCTGGTT TTGCGCGGGG     65400
     ATGGTAGCGA AAGATCCCGT CTCGATTGGA AGGGGCAGGG CGACGCCGTG GAGGTCACAC     65460
     AGCCCTTCGA CATTGATGGC ATTACCATTG ATGGGGGGCT CGATCCGAGA TCGGATCGCA     65520
     GTGTCGGATC TTTCGGCTGC CTTTTCTCAA TCCACGGACC AATGAAGGGG TCTCCAGCCT     65580
     ATTTGTCCGG TATAAGGATT GGCCATCTTC GCGTAAGAAG AACGCGATCC GTGGGGATCG     65640
     TCCTGGCGAA TATCGAGAAT CTGACCGCCG GCCAGATCTT CGTCGAGGAT ATCTTTTGCA     65700
     ACGGCTTGAT CCTCTCCGGT TTGCGCAATT GTGACATTAC GCAGGTGACC GCCAGCAATA     65760
     TCGGGGATTT GAAGGGAACC GGGCATCGAC GAGGATCCGC CGTGGCCATC TTCTCGGAGA     65820
     CCAAACCCGT TGCGAGCTGG TATGATACGC AGCGCATTCT CCCCACCGAT CATTTACACA     65880
     TTGGCCATGC GGAAATTGCG AAGACGACGG ACAGCGCGTT CTATATTCAT GACGATCTGC     65940
     AAACAGGCGT TCATGATGTG ACCATCGATT CTGTGCATGT CGACACGGCT GGTAAAGATG     66000
     GCTTCAAGAC ACGCGCCGGC CCACGGACGG TGAGGGTCGG AACGGTCACC GTCGAGAGAT     66060
     CATCGCTGCG CGGCGTCGAT ATCGAGTCCG ATGATGTCAA AATCGAGCAG ATCGATGTTT     66120
     CGCACATCGG CTTCGACGCC GTGGGAGCCA TTCTCGGCCA TCCGGCGCCT TTCAGCGGCC     66180
     GCGACGCCAC CAACGAGTCG ATCCAAACCC ATCCCAATGG CCTGGTCATC ATGGGTTGTT     66240
     CCGATGTGGA GATCCAGCGC ATGAAGATTG CCGACGTCGC CTCAAATCCT GTCACCGGGG     66300
     CGGAAGGTCA CGGCGTCCAT ATCTCTCGCG CCCACCGGTT CAAGGTGAAA GGAGACGTCA     66360
     TTCGGTGTGA CGGAAATGGC CTAAGGCTTT CGGGAAGTTC GGATTTCGAT ATTGAACTGG     66420
     ACATCACCGA TCCCTGCCGT GGGAGGCTGA CTCAACAGGC TATCCTCCTC ACGCCAGACA     66480
     AAGCGGGTCC AAACTATGAC GGAACGATCC GTTCGCAGAT CACGCATACG TCAATGAATC     66540
     CCCCTCGCTT TGCACTGGAC ATTGATGACT CCTGTGGCAT CAATGCGACC ATAAAAATTC     66600
     GGCCTGACAA TCCAAGTGAT GGCTCAATGG TAATACGCGA CAATTCGCGT AAAACCTGCG     66660
     GCGCATACAG CAATGATATC AAGCGACGTT AAGGGGCCAG AAGACATGGT TGAATTGTGA     66720
     TGGCGGC                                                               66727
//

If you have problems or comments...

PBIL Back to PBIL home page