(data stored in ACNUC8465 zone)

HOGENOMDNA: BEII9_2

ID   BEII9_2; SV 1; empty ; DNA; empty ; PRO; 181736 BP.
XX
AC   NC_010580;
XX
PR   Project: 59057;
XX
DE   Beijerinckia indica subsp. indica ATCC 9039 plasmid pBIND01, complete
DE   sequence.
XX
OS   Beijerinckia indica subsp. indica ATCC 9039
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Beijerinckiaceae; Beijerinckia.
XX
RN   [1]
RP   1-181736
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., LaButti,K., Schmutz,J., Larimer,F.,
RA   Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Dunfield,P.F.,
RA   Dedysh,S.N., Liesack,W., Saw,J.H., Alam,M., Chen,Y., Murrell,J.C. and
RA   Richardson,P.;
RT   "Complete sequence of plasmid1 of Beijerinckia indica subsp. indica ATCC
RT   9039";
RL   Unpublished
XX
RN   [2]
RP   1-181736
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (11-APR-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-181736
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., LaButti,K., Schmutz,J., Larimer,F.,
RA   Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Dunfield,P.F.,
RA   Dedysh,S.N., Liesack,W., Saw,J.H., Alam,M., Chen,Y., Murrell,J.C. and
RA   Richardson,P.;
RT   "Direct Submission";
RL   Submitted (26-MAR-2008) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001017.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082525
CC   Source DNA available from Peter Dunfield (pfdunfie@ucalgary.ca)
CC   Bacteria available from ATCC: ATCC 9039
CC   Contacts: Peter Dunfield (pfdunfie@ucalgary.ca)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..181736
FT                   /mol_type="genomic DNA"
FT                   /db_xref="ATCC:9039"
FT                   /db_xref="taxon:395963"
FT                   /note="type strain of Beijerinckia indica subsp. indica"
FT                   /strain="ATCC 9039"
FT                   /plasmid="pBIND01"
FT                   /organism="Beijerinckia indica subsp. indica ATCC 9039"
FT   gene            46..585
FT                   /db_xref="GeneID:6197938"
FT                   /locus_tag="Bind_3677"
FT   CDS_pept        46..585
FT                   /locus_tag="Bind_3677"
FT                   /gene_family="HOG000057757" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2635 hypothetical protein"
FT                   /db_xref="GI:182676826"
FT                   /db_xref="GeneID:6197938"
FT                   /translation="MRQTFSVSSRVAPLILTLGLGACATPIPTYVDVPGMANPELALRE
FT                   SFASVDAETAKLGSLDLKDPLPPSPVSKSAETPARPAKSLSPLQRTGVVPGELQRVVQF
FT                   QFNGSLDDGVTQLGKIIGYDVAIQAPPNAEPQPIVVEAVEAPVVDYLRSIGKAVGDRAT
FT                   VQIDPQHHQIQVIHHV"
FT                   /protein_id="YP_001830973.1"
FT   sig_peptide     46..120
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.664 at
FT                   residue 25"
FT                   /locus_tag="Bind_3677"
FT   gene            578..1543
FT                   /db_xref="GeneID:6198054"
FT                   /locus_tag="Bind_3678"
FT   CDS_pept        578..1543
FT                   /locus_tag="Bind_3678"
FT                   /gene_family="HOG000057758" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DotC"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2636 DotC"
FT                   /db_xref="GI:182676827"
FT                   /db_xref="GeneID:6198054"
FT                   /translation="MSERRAPHGRRLGLTLVAGLTFLPPAHAENNVTILQIPPEPSLRE
FT                   IEQAARETGNPLSKPVTGAKQIPAITGGERPPSLEALQAALPGPQPGDGLEPGRGDILY
FT                   QAALTFGAQGGLAARAFGINEMLRRYEPTLDSVFDFRTVVVRVGPGRTLMRPPIVTAAQ
FT                   MAFALGEGAQVARETACVYQITRRAQLASAPPNWRTYLVRSWASPSKPSDAVLPRTEQE
FT                   VNWWKKWVAEGWAQGERQGVEIFLADLSRLQRDYIGMVRYRVLLRAGLVENPRVAFEDS
FT                   LVNGGHEEMRAGDRVIRITDQPGLRADRKSWPKNTRDCPQ"
FT                   /protein_id="YP_001830974.1"
FT   sig_peptide     578..664
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT                   /locus_tag="Bind_3678"
FT   gene            1540..2682
FT                   /db_xref="GeneID:6197942"
FT                   /locus_tag="Bind_3679"
FT   CDS_pept        1540..2682
FT                   /locus_tag="Bind_3679"
FT                   /gene_family="HOG000278042" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type II secretion system protein E"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   gox:GOX2639 twitching motility protein PilT"
FT                   /db_xref="GI:182676828"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="GeneID:6197942"
FT                   /translation="MNAPLSTVWQGRGADPWVRDPRKSAPGLDHLLTWAYRQGASRIAF
FT                   LSGHPVWVRIHGLNQPVEPDPIPESDLALITNHIYGADGTARLKKGQDFDLTYEVLLDR
FT                   GTRLRFRINATATRTSRRDGVNIILRPIPDKPPTLEQQRVEQGILESFRPHEGMVIVSG
FT                   ATGSGKSTLIAGMTMAKLNDPNGHYNIIEGAAPIEFMFDRMRSDSSTIVQSEIPIDLPT
FT                   FEAFIRGCMRREPTDIIVGECRDSVTMAAAIQAAISGHTLTTTIHANDVALTMQRIASL
FT                   CPPDERDNLISAVAQSLRLVINQKLIRSSDGKRIALREFLVFNRALRTTFLETDPKLWP
FT                   ALTRQAIATEGQSYEQAINRLLEAGLISEETAAHERKEIG"
FT                   /protein_id="YP_001830975.1"
FT   misc_feature    1621..2655
FT                   /note="Tfp pilus assembly protein, pilus retraction ATPase
FT                   PilT [Cell motility and secretion / Intracellular
FT                   trafficking and secretion]; Region: PilT; COG2805"
FT                   /db_xref="CDD:32636"
FT                   /locus_tag="Bind_3679"
FT   misc_feature    2008..2613
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bind_3679"
FT   misc_feature    order(2026..2031,2041..2049)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bind_3679"
FT   misc_feature    order(2029..2031,2041..2049,2107..2109,2113..2118,
FT                   2260..2265)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bind_3679"
FT   misc_feature    2248..2262
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bind_3679"
FT   gene            2682..2930
FT                   /db_xref="GeneID:6197930"
FT                   /locus_tag="Bind_3680"
FT   CDS_pept        2682..2930
FT                   /locus_tag="Bind_3680"
FT                   /gene_family="HOG000278994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IcmT"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2640 IcmT"
FT                   /db_xref="GI:182676829"
FT                   /db_xref="GeneID:6197930"
FT                   /translation="MWRNTARPVMVVFLDARACFPVLAFFMYWSWTTAKIAIFGTLFFG
FT                   MISWLGLTLPSFVRLLRRWINGSLRPAIPAWKRRRFA"
FT                   /protein_id="YP_001830976.1"
FT   gene            2927..3355
FT                   /db_xref="GeneID:6197941"
FT                   /locus_tag="Bind_3681"
FT   CDS_pept        2927..3355
FT                   /locus_tag="Bind_3681"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676830"
FT                   /db_xref="GeneID:6197941"
FT                   /translation="MNEELSPVLVGRGVTALFKLTPRPLRLHDPVYGTVRDIPSEAIGE
FT                   VDGLLPLFLAAAEAIWFEAFGHGFALKLCIDHQSLLGYRVVSLGCVGFVGVMLHLMEAI
FT                   FQIARPDMILLNDFSVVWQSAKIRLGVASDTDALLSIA"
FT                   /protein_id="YP_001830977.1"
FT   gene            3364..3876
FT                   /db_xref="GeneID:6197940"
FT                   /locus_tag="Bind_3682"
FT   CDS_pept        3364..3876
FT                   /locus_tag="Bind_3682"
FT                   /gene_family="HOG000057759" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lytic transglycosylase catalytic"
FT                   /transl_table="11"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   bvi:Bcep1808_7655 lytic transglycosylase, catalytic"
FT                   /db_xref="GI:182676831"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="GeneID:6197940"
FT                   /translation="MFFKPGLFGVAFAVLSASITHADPLMSEGQKVLACIEASAEIHHL
FT                   PSGLLLTLLRVEAGELGKVSQNKNRTVDIGPMQINDSWVHKIARHWGASDAETYRALRD
FT                   NFCANVAGGGWILRQTLDEAKGDIWEGVALYHSHTPVHKVRYLHQVLHHLHALQKEAQV
FT                   SSRNSGS"
FT                   /protein_id="YP_001830978.1"
FT   sig_peptide     3364..3432
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT                   /locus_tag="Bind_3682"
FT   misc_feature    3565..>3774
FT                   /note="Lytic Transglycosylase (LT)  and Goose Egg White
FT                   Lysozyme (GEWL) domain. Members include the soluble and
FT                   insoluble membrane-bound LTs in bacteria, the LTs in
FT                   bacteriophage lambda, as well as, the eukaryotic
FT                   'goose-type' lysozymes (GEWL).  LTs catalyze...; Region:
FT                   LT_GEWL; cd00254"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="Bind_3682"
FT   misc_feature    order(3601..3603,3709..3711,3766..3768)
FT                   /note="N-acetyl-D-glucosamine binding site; other site"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="Bind_3682"
FT   gene            3876..5024
FT                   /db_xref="GeneID:6197999"
FT                   /locus_tag="Bind_3683"
FT   CDS_pept        3876..5024
FT                   /locus_tag="Bind_3683"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2637 hypothetical protein"
FT                   /db_xref="GI:182676832"
FT                   /db_xref="GeneID:6197999"
FT                   /translation="MMAGGNGARADYTVFSTIVIVLGLGLGGWMLWQSQHGEISAALMQ
FT                   FYHWQIQHLQGFTHRFDLADRQMLAANPDRVEIGTLIRMARALGQFFLYPAVGLVLWLA
FT                   VVCFIYAASSRYCRALDLEGLMREQAQSHPGITPFITRSLRLLPLDKAFVRSLDPALNV
FT                   REWVERHALTSDGTFDRAAARCELIRQLGDPWQGPDKANPTVRCMLAVFMLHAAGKRKE
FT                   VAEFLGQMAEDLSDGKGEGAAGPDMPLHFSAPVVQRADYWLKDRDCLIALLGPLSQPKH
FT                   GYTATMLMSALTQARLVSGVLAPAQFNFLKLVDRKLWFALHSLGFPTSGKSLETHPNPR
FT                   VEAIGARDHWSAERVFGAPLRHPSVDQAVEAIAEAFTRLSYE"
FT                   /protein_id="YP_001830979.1"
FT   gene            5039..5578
FT                   /db_xref="GeneID:6198048"
FT                   /locus_tag="Bind_3684"
FT   CDS_pept        5039..5578
FT                   /locus_tag="Bind_3684"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676833"
FT                   /db_xref="GeneID:6198048"
FT                   /translation="MSQIVLYSGFDQVEAQPIYLHFDDDLKECRLRIVPSSGTGLHVHI
FT                   ERDETRRFGLFRKKVPNEAASVGESRRFVRDPTLVAVLITVAGMSFSWIVMHVAKTILE
FT                   KPDIELVAKAPAANPVQAVPANPAYRIWENTRVGTSQPDPELKVVTDNLRHAPIVTPAP
FT                   GSDPNSPSGPTAFGLE"
FT                   /protein_id="YP_001830980.1"
FT   gene            5588..5854
FT                   /db_xref="GeneID:6197928"
FT                   /locus_tag="Bind_3685"
FT   CDS_pept        5588..5854
FT                   /locus_tag="Bind_3685"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: oan:Oant_1559 hypothetical protein"
FT                   /db_xref="GI:182676834"
FT                   /db_xref="GeneID:6197928"
FT                   /translation="MQRLSCCIPFCRATRGDRKNDPLRPGLEWICSRHWRDVPVVLKAE
FT                   KSHWQRLSRPAKAKGLETPRIHARAFAAWEACKASAIEAAMGL"
FT                   /protein_id="YP_001830981.1"
FT   gene            5886..8246
FT                   /db_xref="GeneID:6197932"
FT                   /locus_tag="Bind_3686"
FT   CDS_pept        5886..8246
FT                   /locus_tag="Bind_3686"
FT                   /gene_family="HOG000057760" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DotL"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2641 DotL"
FT                   /db_xref="GI:182676835"
FT                   /db_xref="GeneID:6197932"
FT                   /translation="MIMREIAGPQGRFERTGAQNLRDTRSITQRFASALVTNFSAVMLT
FT                   VGAGAMVIEPASVELIAPASLLYAGIVLTRRVKLPMRLPKSARIKDWNYPDPSSRKPRM
FT                   AAGTIYLGRDIETNHELWLTPEDGRQHATIPGTTGAGKTTAIVSFLTNALTQGSGFVLV
FT                   DGKADNKLYGEILALARRFGREDDVLALNFLVASGEKQSNTFNPFATGNADAIRELLAS
FT                   QLGEQNAQDSNGVFRARAVALIGTIAPVLTWMRDHRGVPISIETIRFCLELRWIWTLAT
FT                   HRLFMVRDPSNGKIIEYDVSKDMPEEIIYPMQAYLGELPGYDSSVPWNQQKDNKPSEQH
FT                   GYALMYFTATFTQLAVSLGHIFKVLNGDIDIRDVVLNRRILVVSLPALENSDDTLAALG
FT                   KIVVASLRGMMAQILGAKLEGDYAQIVENKPGMGVAPFMVVLDELAYYATGGLDRMLAM
FT                   GRGLNIMFWLAFQEVSGIWARIGEKTASLLGNANLTVAMRQQDAQRTREWLEQTAGQTY
FT                   VTQAGGYQTGELGTYLESQHADLRQVSRIDWRDLQSLIEGEAIILFGGRRIYAKLFHAK
FT                   VDVSGPMRLNRCLALLPPKPEVLSQEEARLSELIATFQNGLIGFGVEGPSDPVLEAGLG
FT                   AFRQELKKGSSIDQGLQEVFEAIDALPHELAQSSLVIQKDEALRPIKTPFTDLLETSRT
FT                   GWPLPPASFGLPREPIDQRLFLDVVEIERTIGASQSAARKTALDLLALRDLALRDEQNE
FT                   PRPAVSVEDQKRKLRSLIETFEAIAEAGELVPI"
FT                   /protein_id="YP_001830982.1"
FT   misc_feature    <6258..7592
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bind_3686"
FT   gene            8344..8592
FT                   /db_xref="GeneID:6198020"
FT                   /locus_tag="Bind_3687"
FT   CDS_pept        8344..8592
FT                   /locus_tag="Bind_3687"
FT                   /gene_family="HOG000117056" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prevent-host-death family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: bam:Bamb_4837
FT                   prevent-host-death family protein"
FT                   /db_xref="GI:182676836"
FT                   /db_xref="InterPro:IPR003756"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="GeneID:6198020"
FT                   /translation="MAHIVLAEITASISELKKNPMGTVAAGEGAAVAILNRNEPAFYCV
FT                   PARTYEAMLERLEDMELNAIADARANDPVIKVNLDDL"
FT                   /protein_id="YP_001830983.1"
FT   misc_feature    8350..>8550
FT                   /note="Phd_YefM; Region: PhdYeFM; cl09153"
FT                   /db_xref="CDD:186840"
FT                   /locus_tag="Bind_3687"
FT   gene            8582..8869
FT                   /db_xref="GeneID:6197933"
FT                   /locus_tag="Bind_3688"
FT   CDS_pept        8582..8869
FT                   /locus_tag="Bind_3688"
FT                   /gene_family="HOG000219994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="addiction module antitoxin"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: bam:Bamb_4836
FT                   addiction module toxin, RelE/StbE family"
FT                   /db_xref="GI:182676837"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR012753"
FT                   /db_xref="GeneID:6197933"
FT                   /translation="MTYELAFVDAALKEWHKLDRNTREQFKKKLTERCENPRVPSAKLS
FT                   GSTDRYKIKLRSVGYRLVYEVREAEILVVVIAIGKRERSEVYKAAERRDL"
FT                   /protein_id="YP_001830984.1"
FT   misc_feature    8582..8845
FT                   /note="Plasmid stabilisation system protein; Region:
FT                   Plasmid_stabil; cl11422"
FT                   /db_xref="CDD:164217"
FT                   /locus_tag="Bind_3688"
FT   gene            9808..10167
FT                   /db_xref="GeneID:6198017"
FT                   /locus_tag="Bind_3689"
FT   CDS_pept        9808..10167
FT                   /locus_tag="Bind_3689"
FT                   /gene_family="HOG000057755" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676838"
FT                   /db_xref="GeneID:6198017"
FT                   /translation="MSKFTDLLALATPGLWFVEPGQKLMADDTLLPIDWIKSGDDLGCI
FT                   GAAHFVGPGVNERQRGYANALLFSASREMALLLEEALTVYDNEFENDLEISGADLLDWF
FT                   FNWRLRVKRLVNELC"
FT                   /protein_id="YP_001830985.1"
FT   gene            complement(10218..11063)
FT                   /db_xref="GeneID:6197936"
FT                   /locus_tag="Bind_3690"
FT   CDS_pept        complement(10218..11063)
FT                   /locus_tag="Bind_3690"
FT                   /gene_family="HOG000233517" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: cak:Caul_2656 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:182676839"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:6197936"
FT                   /translation="MIPDLPSPLLRSFVAVVDCGSLATAAVRVGRSESALSLQMSRLEN
FT                   IVGQPLFDRDGRALKVNQVGSHLLGHARAILRRIDAARAELGPAATPLIRVGVVQDFVV
FT                   PVLRPTLIDLRATNPNTTFEIVIGSTAELLQAMGEDRIDTALCADDPGRGKAVTSFPME
FT                   WFGKPDLLAEEVLPLVSITPPCPFLKAAQQALDAIGWSWRIALVTPSLDGLRTAVEAGL
FT                   GIASRTEVGIGLPPLSDGILPQLPSITYTVIERRRGKDGPGQAAVRMTAHLVSLAGTVE
FT                   "
FT                   /protein_id="YP_001830986.1"
FT   misc_feature    complement(10257..11039)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bind_3690"
FT   misc_feature    complement(10869..11039)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Bind_3690"
FT   misc_feature    complement(10308..10787)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Bind_3690"
FT   misc_feature    complement(order(10404..10409,10413..10418,10434..10451,
FT                   10683..10703,10707..10709,10719..10721,10728..10733,
FT                   10737..10742))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bind_3690"
FT   gene            11154..11570
FT                   /db_xref="GeneID:6197937"
FT                   /locus_tag="Bind_3691"
FT   CDS_pept        11154..11570
FT                   /locus_tag="Bind_3691"
FT                   /gene_family="HOG000225421" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xau:Xaut_1169 4-oxalocrotonate tautomerase"
FT                   /db_xref="GI:182676840"
FT                   /db_xref="GeneID:6197937"
FT                   /translation="MPFARLTLTSIPTLDQANHLATELTELIAHDLGKRQELTSILVET
FT                   SGISHWAIGAEGRLTAAHLEVCVTAGTNSEQEKRAFIANAMTILRTVLPGLNPATYVVI
FT                   RELPATDWGYDGRTQADRAMDRIHGTALIGQEKS"
FT                   /protein_id="YP_001830987.1"
FT   misc_feature    11154..11321
FT                   /note="4-Oxalocrotonate Tautomerase:  Catalyzes the
FT                   isomerization of unsaturated ketones. The structure is a
FT                   homohexamer that is arranged as a trimer of dimers. The
FT                   hexamer contains six active sites, each formed by residues
FT                   from three monomers, two from one...; Region:
FT                   4Oxalocrotonate_Tautomerase; cl00235"
FT                   /db_xref="CDD:185852"
FT                   /locus_tag="Bind_3691"
FT   misc_feature    11340..11531
FT                   /note="4-Oxalocrotonate Tautomerase:  Catalyzes the
FT                   isomerization of unsaturated ketones. The structure is a
FT                   homohexamer that is arranged as a trimer of dimers. The
FT                   hexamer contains six active sites, each formed by residues
FT                   from three monomers, two from one...; Region:
FT                   4Oxalocrotonate_Tautomerase; cl00235"
FT                   /db_xref="CDD:185852"
FT                   /locus_tag="Bind_3691"
FT   gene            complement(11638..14844)
FT                   /db_xref="GeneID:6197927"
FT                   /locus_tag="Bind_3692"
FT   CDS_pept        complement(11638..14844)
FT                   /locus_tag="Bind_3692"
FT                   /gene_family="HOG000057763" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TrwC relaxase"
FT                   /transl_table="11"
FT                   /note="PFAM: TrwC relaxase; SMART: AAA ATPase; KEGG:
FT                   gox:GOX2642 conjugal transfer protein TraA"
FT                   /db_xref="GI:182676841"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="GeneID:6197927"
FT                   /translation="MMNFRKISADSQGVVLRTYFTEGKTAPIHDPTKHPEKQLEPGSRL
FT                   TSYYTGRDSRATWRPDITPAFAKAAGIDPSQMPTSEALDRLFEGKRGDNGERWSQHERT
FT                   LSGFDFTFSPHKSVTIAAEFAVTPAESAAIWNAIDRANDAAMRYAAGRLGFARRGKGGE
FT                   EGVDPGDVGWVSFRHHVARPTVELQDGKSGATYLVEAKTAGDPQAHIHNFLMNMVVTAD
FT                   GRVGSLNTKELTSDLTHELGGYFQARLADELRRLGAEIGYDKKDEAVVLEAIPQKAVDT
FT                   FSKRRQQVLRSAKAFAKSQGLDWDELSIERKQTILNESSVVSRYAKQDGKGEKEAWKAQ
FT                   AEAIGWRHETVLNGVRHEALTDAERYDKAYDFAAKRLAEDFKTAAVLNHDRLRVHAVRG
FT                   LIGAGIAHGRDDIDKVVTLLEQRGLTLQGEHVALITSRMEDKVRITNTAQIRIETELAN
FT                   KARAVARDKDGALSAQTVKAAINASGLDFTTEPEHGAAQRAAIHALGEGGRLTLLTGVA
FT                   GSGKTTLLQPLVAAWKADTRYDAGGREVIGVATAWRQADALKDAGIDKTVALQPFLQSL
FT                   GVEGQPDTTTLANAGIEKTAGVEALLQAIDKGTVKPTHNTVIVIDEVSQIGPRAMLKLL
FT                   EVQAETGMTIKALGDREQAQSIEAGDTIEILKRVLPKEALPALLTTVRQRTRRDRDIAN
FT                   LFREGKAGEALGMKIEDGTARLLGGDQDQVIGQIADLYMQRRDILRAEDPKKSITVSAL
FT                   TNQDAADISQAIRERLKARGEIGADEKLYKAIDQRGETYDLRIATGDKLRLYRRTWATI
FT                   DGKGGSIGDNGDIVEVVGRSADGFTFKDKKGRIGSVEMRRLIDPKTQRLMLGYGHALTI
FT                   DAAQGLTSEEHINALPRGSAGISSFKGYVAESRSRGATWTLVSGAAVHEAEKRSRALGD
FT                   ASPVTTEDIWKRIAADMATKNYKPLATDLIGTLRRHREQAVETLLTLGLKAEGKEGKSK
FT                   ELGRDLRQLIRAKVVQEQVDPEVAALNAAIKENGKRLDALSKRAASFLEEMQAETQEQQ
FT                   RKLAEARQRNEASPSPAAGK"
FT                   /protein_id="YP_001830988.1"
FT   misc_feature    complement(13807..14718)
FT                   /note="TrwC relaxase; Region: TrwC; cl08490"
FT                   /db_xref="CDD:164117"
FT                   /locus_tag="Bind_3692"
FT   misc_feature    complement(12211..>13530)
FT                   /note="Ti-type conjugative transfer relaxase TraA; Region:
FT                   TraA_Ti; TIGR02768"
FT                   /db_xref="CDD:163008"
FT                   /locus_tag="Bind_3692"
FT   gene            complement(14841..15140)
FT                   /db_xref="GeneID:6198091"
FT                   /locus_tag="Bind_3693"
FT   CDS_pept        complement(14841..15140)
FT                   /locus_tag="Bind_3693"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676842"
FT                   /db_xref="GeneID:6198091"
FT                   /translation="MAISSTGPEPTTENRLQAIQMVQTEQTAILGTLVKQNALILELLT
FT                   PPEMDPDRVPLDKLLTDLVRQSKDQLNLLQQILKLLQMGRETPAAPNGQGDARR"
FT                   /protein_id="YP_001830989.1"
FT   gene            15688..16098
FT                   /db_xref="GeneID:6197934"
FT                   /locus_tag="Bind_3694"
FT   CDS_pept        15688..16098
FT                   /locus_tag="Bind_3694"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676843"
FT                   /db_xref="GeneID:6197934"
FT                   /translation="MTWKFKTKKGVFDYAPEFEEQYSVNDDGTEIRLGGTISRSYTHLS
FT                   FEYEGRGVKFRFSAMPITEYIKKNDLYNLGKVCTVYISSANKIYISHDLGLKIAEDIRD
FT                   MLIDTYKYYRFSGDSHLEDVVFDQYAKAFLNI"
FT                   /protein_id="YP_001830990.1"
FT   gene            16129..24864
FT                   /db_xref="GeneID:6197929"
FT                   /locus_tag="Bind_3695"
FT   CDS_pept        16129..24864
FT                   /locus_tag="Bind_3695"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proprotein convertase P"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; Hemolysin-type calcium-binding region;
FT                   Proprotein convertase P; Haemolysin-type calcium binding
FT                   domain protein; KEGG: pol:Bpro_4929 hemolysin-type
FT                   calcium-binding region"
FT                   /db_xref="GI:182676844"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR010566"
FT                   /db_xref="GeneID:6197929"
FT                   /translation="MLDATTLAQLQNIANAQTNVGVKNAVVNIINLATGSNPASSTLAQ
FT                   TVNTLLGGPNGPMSAKANGSALFYSDDDNNPGKPNLQAAKDCQTSLKGNGYFLADTQAG
FT                   VAAEKLANQADALSGAVNTSPAGDAIMGLASAMMGAQADNAYAFVSNAYSGSIWTQYEL
FT                   PALLGQTGSEVGTVNGLNLSNYNNYSPSQIQNLISASQACDPNNLPPPTGGVPANDNLS
FT                   TTQMIALGLLGAATTVGVGALIILGAPVEIPALGVGGIMLLLTTSQAAAKPIAPTTTDA
FT                   ASQYQFQWQLNTYNGAQIAPALGYILAQAQGAPNVSSLAMQVQPSLVSLRNLVTQSNSP
FT                   LFAQTTDSSGNLVNVTIQSNSSNSLLIQLASATATTAVNPATIDVGFNNSGGTSFEQTT
FT                   VTNANGSAAVLISGDDNNASINNSTISLNSGATATITGNSNTFALGSDSSVTLNSQGGS
FT                   NTVTVTGDPWFSWLASQTTRFEADANGVRVGYPGGNLGTDYSLNDQGQITAAPVFMGFG
FT                   LGGGYASDSAEAGSLQSSVSGTIPADTSSGPPLDAWLSSVVVINLGGGVGSGTLYTAPS
FT                   GFIQGGRVLSSTDMAVIYPNANNDGVFNNSPSGNVAGYNRSANDQLSAPSQNLQDLVGG
FT                   TVSALQTLSSVSPLFGAALADMASNASSWINTDPLVIGTTSAGITLTNWISNAVYFDTN
FT                   VNPTTLQADGKLHHTSWVSGGTGIVALDRNGNGQIDDITETLSEFFQGGSNPGHYADGL
FT                   DALKSLAQAGASVFSAATSLTDPTTHQSYWSELRVWLDANQNGVTDAGELKTLNDLGIT
FT                   SINLVGSGNLGESLEGSAVTNRTTYTKSDGSSGAVAAVDFATNTVGDIATSANGGITIQ
FT                   SVPEGGATPSNSFVIKNTSAHAYTLSNGQLIDNTTGQTVIASGTKGVFSTNQNDSIAVA
FT                   SSDPTPYWLGGGTGAATLTGGAGNTVFLINSKTIVHGGTGFNIAEVTDAKPITVDLKTA
FT                   NLQEVIGGAGDGVFNASGTNWNVFIQGGSGNNIIIGGTANDALAGGTGDDLIEAGTGGS
FT                   VIHAGAGNDVIYGGSGSTSTAQPAYVNAGNTADISYVERLYEGGFGREASAGELQWCVS
FT                   VLGNGSVDRVTLASYFLSNPEWQNRFGTQTDAQFVTSVFDNFLGRDPSAGELAQFTQAL
FT                   ADGAPRSYALESVADNAQSQTYWGLHHPGASDVIYGGSGHDTIVLGTNNAVVYAGSGTM
FT                   TVVGNANGFSTVGLHGSYADYTLTHNADGTITVTNIGHEDGDGTVTMKNVTALDFKDFI
FT                   QVDIATALGMPVDDTLNTGNASQVTVNASGQYVISAITLLANDLDYAGKSLSIRELLDN
FT                   NGNAIARGSSGQVNGGIAMLSTDGSSITFTPTPGFAGVMSFRYHVEDSDGQTGQSVVQT
FT                   GTSNTAELAATVSLVTPSQPTDPLFAKEWFLQAADVIPLLKHYTGAGVSVGIFDGSGNV
FT                   DFSNPDLSAHAGQSVKLDGTPGITQTGTHATLIAGVLGAAIDGEGAVGVAPDATLNSEA
FT                   VGLVGMSTQTDANLMDWSNYDVVNNSFSVKPPFYNLGLSPAGSASELTAFLNAIQNGRQ
FT                   GYGTIIVMGGGNSRAQGENTNDSYLTSSPYAITVGGINATTDLSTLRISGAPFSDPGYS
FT                   ILISAPANNITSDGVAYTNAYGQNFGSTVKTAEGTSFATPIVSGVVADMLQANPYLSWK
FT                   DVQQILAYSAVKVDPNDTNPFVAGSTAGSGWAFNGATNWNGGGLHYSPDYGFGEVDARA
FT                   AVRLAQSWSSFGIYTDVFSHDTYVISTPLSSGPFSKTFTESSTTDTVETVQVRVKISNA
FT                   IRSNLTITLISPSGVTSTLMARPGSVIGPIADAANFVPGAFDDFTPGTFDYTFMTQADR
FT                   GEAFQGNWTVNISDAAGSTSQAIVTDVKIILQGNYTAGKPQTFIYTDEFATLSSTPGNA
FT                   LYDPNNAARFTLTGSGYQDTLNVSATTGAVNLDLVTGSTDSTIDGRYLAIAPGSKINKV
FT                   YLGDGVSTVHLNADNDIINTGAGNAILYGGAGFDIYNIGKWLQRSIPAGNTTIYGGSGG
FT                   SAVYIGDEAGSNILVGGAGVDTVSYSSASAGVTVNLGVTTAQATRSTGTDTLLGFENLT
FT                   GSAYNDVLTGNGGNNVIDGGAGNDTIDGGPGNDTLIGGAGIDTVSYASATSGVTVSLAL
FT                   TTAQATGGAGTDTLSGFENLTGSAYNDVLTGDSGDNVIDGGAGNDLIDGGLGNDTLIGG
FT                   AGIDTLTYASATSGVTVSLALTTAQATGGAGTDTLSGFENLTGSAYNDVLTGSGGDNVI
FT                   DGGAGNDLIDGGLGNDTLIGGAGVDTVTYVSATSGVTVSLALTTAQATGGAGTDTLSGF
FT                   ENLTGSAYSDVLTGDGGDNVIDGGAGNDTLYGGAGNDTLIGGAGNDKLQGGAGDDTLDG
FT                   GAGTDAASYTQALAGVTVSLAVSGPQNTIGAGTDTLLNIENLTGSIYDDVLTGDAGNNV
FT                   IDGNAGNDLIDGGLGNDTLIGGSGTDTVSYASATSGVTVSLALTTAQNTGGAGTDTLSG
FT                   FENLTGSAYNDVLTGDSGNNVIDGGLGNDTLDGGAGVDTVTYVSATSGVTVSLALTTAQ
FT                   ATGGAGTDTLSGFENLTGSAYSDVLTGDGGDNVIDGGAGNDTLYGGAGNDTLIGGAGND
FT                   KLQGGAGDDTLDGGAGTDAASYTQALAGVTVSLAVSGPQNTIGAGTDTLLNIENLTGSI
FT                   YDDVLTGDAGNNVIDGNAGNDLIDGGLGNDTLIGGTGIDTVTYTSATSGVTVSLALTTA
FT                   QNTGGAGTDTLSGFENLTGSAYNDVLTGDAGNNVINGGAGNDILVGSAGSDTLDGGAGN
FT                   DVYIYHQADGNMLIHDAGDSSGPTPFNTLSFADLTLSNLLFSQSGTDLVIGIAGTGHSI
FT                   TVQNELGASGLDGIQQINFADGSNMTHAQILAHA"
FT                   /protein_id="YP_001830991.1"
FT   misc_feature    20392..21252
FT                   /note="Peptidase domain in the S8 and S53 families; Region:
FT                   Peptidases_S8_S53; cl10459"
FT                   /db_xref="CDD:175216"
FT                   /locus_tag="Bind_3695"
FT   misc_feature    order(20596..20598,20767..20769,21148..21150)
FT                   /note="active site"
FT                   /db_xref="CDD:173787"
FT                   /locus_tag="Bind_3695"
FT   misc_feature    order(20596..20598,21148..21150)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:173787"
FT                   /locus_tag="Bind_3695"
FT   misc_feature    21547..21843
FT                   /note="Proprotein convertase P-domain; Region:
FT                   P_proprotein; pfam01483"
FT                   /db_xref="CDD:110482"
FT                   /locus_tag="Bind_3695"
FT   misc_feature    <22447..22740
FT                   /note="Peptidase M10 serralysin C terminal; Region:
FT                   Peptidase_M10_C; cl12108"
FT                   /db_xref="CDD:164328"
FT                   /locus_tag="Bind_3695"
FT   misc_feature    <23167..>23304
FT                   /note="Peptidase M10 serralysin C terminal; Region:
FT                   Peptidase_M10_C; cl12108"
FT                   /db_xref="CDD:164328"
FT                   /locus_tag="Bind_3695"
FT   misc_feature    <23914..>24051
FT                   /note="Peptidase M10 serralysin C terminal; Region:
FT                   Peptidase_M10_C; cl12108"
FT                   /db_xref="CDD:164328"
FT                   /locus_tag="Bind_3695"
FT   misc_feature    24721..24849
FT                   /note="Haemolysin-type calcium binding protein related
FT                   domain; Region: HCBP_related; pfam06594"
FT                   /db_xref="CDD:148291"
FT                   /locus_tag="Bind_3695"
FT   gene            24960..27122
FT                   /db_xref="GeneID:6197935"
FT                   /locus_tag="Bind_3696"
FT   CDS_pept        24960..27122
FT                   /locus_tag="Bind_3696"
FT                   /codon_start="1"
FT                   /product="type I secretion system ATPase"
FT                   /transl_table="11"
FT                   /note="KEGG: smd:Smed_0884 type I secretion system ATPase;
FT                   TIGRFAM: type I secretion system ATPase; PFAM: ABC
FT                   transporter transmembrane region; ABC transporter related;
FT                   peptidase C39 bacteriocin processing; SMART: AAA ATPase"
FT                   /db_xref="GI:182676845"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR010132"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="GeneID:6197935"
FT                   /translation="MNSSAGDPASGTPLDSGLCALVAIAGFYRIAGDPSQLAHTLALDT
FT                   RAADEEDLVRGAHCLGLKARLLRQATPKRLAVLPRPAIARLRSGSFAILGHAMADGTHR
FT                   LIDPLTRIERMMPLDDLVAAIEPLVILVARRFNGVGTDPKTFGFRWFLPSLWRYRKPLG
FT                   HVLLASLFVQLFALVTPLFFQVVIDKVLPHKGYATLFVLIGGLVLVGLFDAVLNYLRTY
FT                   ALSHTTNRIDVELGQRLFQHLLRLPLGYFESRSAGQTVARLRELEVIRSFLTGQGLFSV
FT                   IDLLFTFIFIGVLLAYSWPLTLVVLAAIPFYVLIAALVRPPLRDKIKERFDRGAESQQF
FT                   LVETVVGMHTVKASAVEPLMQAQWEEKLAASVKTAFSATLLGAGGQNAITYVSKLAHAA
FT                   LLLFGAKAVIDGDLSVGAFIAFTMIAGQVTQPVLRLSQLWQDFQQVQISVERIGDILNA
FT                   PPERFAATLVALPRPTGAIELRNVSFSYRPGAPAIVKNLSLAIPSGAVVGIVGPSGSGK
FT                   STLTKLLQRMYMPDEGQILFDGLDIAQCDPAWLRRHIGVVLQDSLLFNRTIHDNIAFSN
FT                   PAMTRAQAIAMARLAGADAFIGRLPQGYDTLIEERGANLSGGQRQRIAIARALASNPPI
FT                   LIFDEATSALDYESERIIQENMKKITKNRTVIIVAHRLAAVRQCDTILGMIEGRIVEAG
FT                   THDELLARKDGLYARLWRLQNDPVAA"
FT                   /protein_id="YP_001830992.1"
FT   misc_feature    24987..25355
FT                   /note="A sub-family of peptidase C39 which contains
FT                   Cyclolysin and Hemolysin processing peptidases.  Peptidase
FT                   family C39 mostly contains bacteriocin-processing
FT                   endopeptidases from bacteria. The cysteine peptidases in
FT                   family C39 cleave the 'double-glycine'...; Region:
FT                   Peptidase_C39_likeA; cd02417"
FT                   /db_xref="CDD:30270"
FT                   /locus_tag="Bind_3696"
FT   misc_feature    25008..27107
FT                   /note="type I secretion system ABC transporter, HlyB
FT                   family; Region: type_I_sec_HlyB; TIGR01846"
FT                   /db_xref="CDD:162558"
FT                   /locus_tag="Bind_3696"
FT   misc_feature    25455..26255
FT                   /note="ABC transporter transmembrane region; Region:
FT                   ABC_membrane; cl00549"
FT                   /db_xref="CDD:186074"
FT                   /locus_tag="Bind_3696"
FT   misc_feature    26388..27101
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bind_3696"
FT   misc_feature    26490..26513
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bind_3696"
FT   misc_feature    order(26499..26504,26508..26516,26634..26636,26874..26879,
FT                   26970..26972)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bind_3696"
FT   misc_feature    26625..26636
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bind_3696"
FT   misc_feature    26802..26831
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bind_3696"
FT   misc_feature    26862..26879
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bind_3696"
FT   misc_feature    26886..26897
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bind_3696"
FT   misc_feature    26958..26978
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bind_3696"
FT   gene            27119..28564
FT                   /db_xref="GeneID:6197939"
FT                   /locus_tag="Bind_3697"
FT   CDS_pept        27119..28564
FT                   /locus_tag="Bind_3697"
FT                   /gene_family="HOG000274493" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HlyD family type I secretion membrane fusion
FT                   protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family; PFAM: secretion protein HlyD family protein;
FT                   KEGG: smd:Smed_0883 type I secretion membrane fusion
FT                   protein, HlyD family"
FT                   /db_xref="GI:182676846"
FT                   /db_xref="InterPro:IPR003997"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="GeneID:6197939"
FT                   /translation="MKRVLALLGRRGEPRAFRPDQEFLPAALAILETPPSPIGIALLCT
FT                   ICLLAVTALAWASFSRIDVIAVAQGKIQPAGRVKPIQPVETGKVIAIQAANGQHVKQGE
FT                   ILVALDPEDAQAETVALTMSLASFKAEILRRKAALEATKEHLLRPLPLVRWEEEIPRPI
FT                   QEREERVLRGDLALFAAQIEGLVAQRRQKEAEQERLTKTIAAQEALLATLDQRVAMREA
FT                   LVQHSAGTRANLLDAIESRQYQDVILKTQQGQKAENVASLAVLIQDIAKSYETFTAENS
FT                   QKLADAERQADENAQRLVKARVKLGHMLLTSPIDGTVQALSVTTPGQVIASGEEIMRIV
FT                   PDAPVLEIECYLQNKDSGFVRPGQEAVVKVESFPFTRFGTLGADVVRVAQDAIPEPDAQ
FT                   LIEGNPAKSNRSTVFAGAQRVQNLVFPVTLRLAASTMIIEGTPVPLSPGMAVSVEIKTG
FT                   SRRVIDYLFSPLVEVVTSAMRER"
FT                   /protein_id="YP_001830993.1"
FT   misc_feature    27224..28561
FT                   /note="type I secretion membrane fusion protein, HlyD
FT                   family; Region: type_I_hlyD; TIGR01843"
FT                   /db_xref="CDD:130902"
FT                   /locus_tag="Bind_3697"
FT   gene            complement(28835..29197)
FT                   /db_xref="GeneID:6197931"
FT                   /locus_tag="Bind_3698"
FT   CDS_pept        complement(28835..29197)
FT                   /locus_tag="Bind_3698"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prophage antirepressor"
FT                   /transl_table="11"
FT                   /note="PFAM: BRO domain protein; KEGG: ecv:APECO1_4056
FT                   putative anti-repressor protein"
FT                   /db_xref="GI:182676847"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="GeneID:6197931"
FT                   /translation="MNEAPQKPKLEEQPIETQDFYFKDALIRTFLKNSEPWFIASDACA
FT                   ALSHTKPTEATEKLYEIEKDVATYHTPGGPQAGLVISESGLYKLIMTARTEGAKIFRIG
FT                   SRARSCPRSASLAATI"
FT                   /protein_id="YP_001830994.1"
FT   misc_feature    complement(28892..29119)
FT                   /note="BRO family, N-terminal domain; Region: Bro-N;
FT                   pfam02498"
FT                   /db_xref="CDD:145567"
FT                   /locus_tag="Bind_3698"
FT   gene            29603..30187
FT                   /db_xref="GeneID:6198125"
FT                   /locus_tag="Bind_3699"
FT   CDS_pept        29603..30187
FT                   /locus_tag="Bind_3699"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: acr:Acry_3544 hypothetical protein"
FT                   /db_xref="GI:182676848"
FT                   /db_xref="GeneID:6198125"
FT                   /translation="MSKANTAQFFESVKAHGFVRRSAVYRWMWTNYDDLSELLKEARPS
FT                   WIVIARELNGIGLRDARGRDLASDNIRRVWLRVSRDLEKERQAARAQQRPAEPATSARE
FT                   EPKRFNPSRLPANYRPDVEIKPQPSVPATSGPYQVPASIDVSEVPEFYTRKDGTVVHRT
FT                   QEQRERIAQQRAGFEKETRHIDRYILTQKAK"
FT                   /protein_id="YP_001830995.1"
FT   gene            30201..30986
FT                   /db_xref="GeneID:6198124"
FT                   /locus_tag="Bind_3700"
FT   CDS_pept        30201..30986
FT                   /locus_tag="Bind_3700"
FT                   /gene_family="HOG000057764" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2663 hypothetical protein"
FT                   /db_xref="GI:182676849"
FT                   /db_xref="GeneID:6198124"
FT                   /translation="MSLSLEHINDRNPVLFIAIGRQQAGKTTFLNTTAQYLKERGGTFQ
FT                   IWNADLLNKTHGLKLFHDETIEAPSLTRDDVKAWLQGKIKEQARERFDAVLDFGCGDKP
FT                   LESLIEAVPEIATLQQQGIRVVVAHLIGPRLHDAKYLDGFSQPSTLTPDGTLIVCNGGV
FT                   VPENRDEKLAFQEIMRHGAIEAALSKGALVQLFPRFSLMLDVTERELTFNEAMNGVEGQ
FT                   DGRAFGLVDRARVEKWWIHLVPDFFQEVPTEWLPSVQRN"
FT                   /protein_id="YP_001830996.1"
FT   gene            30959..31963
FT                   /db_xref="GeneID:6198123"
FT                   /locus_tag="Bind_3701"
FT   CDS_pept        30959..31963
FT                   /locus_tag="Bind_3701"
FT                   /gene_family="HOG000057764" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: acr:Acry_3545 hypothetical protein"
FT                   /db_xref="GI:182676850"
FT                   /db_xref="GeneID:6198123"
FT                   /translation="MATFRSAELNAVVIHNPAGLFRTTRRTGQKNSWSRFMVQSYEQNG
FT                   ERKPVLLIALGRQRVGKTVFLNTLAQYLKQKGARFEILNADLLNKTHTLTLFHKDTVEA
FT                   PSTHREDMQAWLVAQFRRQMDERFDAILDVGGGDTPLERLIEEYPIVSVLQDHGIRLVI
FT                   AQVIGPDMADVDYLERFTERSTLMPDGMLIVFNGGLVLTGRSANVAFSEVAKHQAIDTA
FT                   VDQGAIIKVFPRLPCMQEVTDRHLTFLEVMNGEKGRGSQAFCPFDQARVNRWWTVEVPE
FT                   FFGGVPSEWLPAIPENGAAPMPAVVGNEPKASKKERKDAQKLAEVDSSESLNG"
FT                   /protein_id="YP_001830997.1"
FT   gene            31956..32573
FT                   /db_xref="GeneID:6198122"
FT                   /locus_tag="Bind_3702"
FT   CDS_pept        31956..32573
FT                   /locus_tag="Bind_3702"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676851"
FT                   /db_xref="GeneID:6198122"
FT                   /translation="MAKTEEQASLVHQRVLRLSEELDQDLAAIQAAGREWGLRHDHPEG
FT                   AFVTAMMHAIKRTGELTVAAANDLNTVAETSRKTAQVELQRLGLANDQALLLVEHARIE
FT                   RVNFSQDRDAQVAKMVAKLGEDLVTGVRDWTVMRERELNRKWAFNRAVIASLIAVSIFV
FT                   GGYGARIYQEKGVGMNGEPCKASSLYRAANGEIWCKVSGTAQ"
FT                   /protein_id="YP_001830998.1"
FT   gene            32686..33387
FT                   /db_xref="GeneID:6198121"
FT                   /locus_tag="Bind_3703"
FT   CDS_pept        32686..33387
FT                   /locus_tag="Bind_3703"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B1040 hypothetical protein"
FT                   /db_xref="GI:182676852"
FT                   /db_xref="GeneID:6198121"
FT                   /translation="MFCDFEDPGSLERSKVRRTLIFIIEVSLMALAIGSVVGLTKSYAD
FT                   PALATQNGLPQVPREYVPEIGAPAMVYPTSPTSSDASSTGNSSSAGNSNGTGGSSGTNW
FT                   NYPGTGSGVSGATVAQNYSSYNGQSVGSGECVALVQATSNVGLTSTWSPGVQVQGNTDI
FT                   AAGTVIATFGSNGTYTNTYGQSHAAIYLGQNSSGIQVMDQWLGQAAQTRTIPWTTQNSY
FT                   ESGSQFYVVSH"
FT                   /protein_id="YP_001830999.1"
FT   gene            33371..33709
FT                   /db_xref="GeneID:6198120"
FT                   /locus_tag="Bind_3704"
FT   CDS_pept        33371..33709
FT                   /locus_tag="Bind_3704"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676853"
FT                   /db_xref="GeneID:6198120"
FT                   /translation="MLFRIKALLLLQALFFSQTALAGSLCQTGLKGITLTAGTYDPPGI
FT                   LAPDSQLLKPIGQWPENLIEQGWHNLRKAPRPLVFTCRYKDGREETILLSEKVDACFLR
FT                   AGLSFNCE"
FT                   /protein_id="YP_001831000.1"
FT   sig_peptide     33371..33439
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT                   /locus_tag="Bind_3704"
FT   gene            33800..34690
FT                   /db_xref="GeneID:6198119"
FT                   /locus_tag="Bind_3705"
FT   CDS_pept        33800..34690
FT                   /locus_tag="Bind_3705"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2604 hypothetical protein"
FT                   /db_xref="GI:182676854"
FT                   /db_xref="GeneID:6198119"
FT                   /translation="MFCFIEDVESPDRSSGRRPLIFHLEVSLMAVGMAVVGMPKSHAAP
FT                   GLATQNGLPEVPHEYVPEIGAPAFVYDTGPANGNPSTPVNSSTDNSSYSSLTGSTNGGS
FT                   DNGGASLDTMLSKSWGTAAQAVAQAMGINPSALAATCMMESGCSNAGAASGSSASGAFQ
FT                   MINSTYTADINQAVASGLVSNYNVDTSLAGKMDPANEAIAASQDLKNAATRLQSMGISN
FT                   PTVLDTRAVYQFGAGIGPSVAKADASANLNDIVGLTAQQLQNNGLTATTTVGQWRATVA
FT                   QKLGNTANQVVLASQ"
FT                   /protein_id="YP_001831001.1"
FT   gene            34705..35100
FT                   /db_xref="GeneID:6198118"
FT                   /locus_tag="Bind_3706"
FT   CDS_pept        34705..35100
FT                   /locus_tag="Bind_3706"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676855"
FT                   /db_xref="GeneID:6198118"
FT                   /translation="MYKATFCFISIAFISTIVSNAIALTAVKPVTELKCMLLNLPDEVI
FT                   RAYEGLPSEYAEAKENSKEIGKAEKFVFVYRTQTETNGFLKVVRSDWTQGWIKVDLLKE
FT                   YQAPSPRSKHCIPSKMSDGSLGFRLDP"
FT                   /protein_id="YP_001831002.1"
FT   sig_peptide     34705..34776
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.675 at
FT                   residue 24"
FT                   /locus_tag="Bind_3706"
FT   gene            35259..35504
FT                   /db_xref="GeneID:6198117"
FT                   /locus_tag="Bind_3707"
FT   CDS_pept        35259..35504
FT                   /locus_tag="Bind_3707"
FT                   /gene_family="HOG000274260" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcription factor"
FT                   /transl_table="11"
FT                   /note="PFAM: Rv0623 family protein transcription factor;
FT                   KEGG: bbt:BBta_p0292 hypothetical protein"
FT                   /db_xref="GI:182676856"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="GeneID:6198117"
FT                   /translation="MPLFIKDASVDELAAELAHLLSVNKTEAVRLALRQALDREKATES
FT                   LAEQAVRFCRDLRARSHPERGQPADKAFFDELNGGL"
FT                   /protein_id="YP_001831003.1"
FT   misc_feature    35259..35489
FT                   /note="Rv0623-like transcription factor; Region:
FT                   PSK_trans_fac; cl01834"
FT                   /db_xref="CDD:154614"
FT                   /locus_tag="Bind_3707"
FT   gene            35504..35902
FT                   /db_xref="GeneID:6198116"
FT                   /locus_tag="Bind_3708"
FT   CDS_pept        35504..35902
FT                   /locus_tag="Bind_3708"
FT                   /gene_family="HOG000075568" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PilT domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   bbt:BBta_p0291 hypothetical protein"
FT                   /db_xref="GI:182676857"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="GeneID:6198116"
FT                   /translation="MFVDASALVAMLTNEDDAADLAQRLSQTSKRLTTPIAIFETAAAV
FT                   ARVLDLPFDEAREAVETFLQLLNVQVLALPPRASTLALEAFERYGKGRGHPAQLNMGAC
FT                   FSYACARYYRMPLLYKCDDLRQTDIERG"
FT                   /protein_id="YP_001831004.1"
FT   misc_feature    35504..35896
FT                   /note="PIN domain; Region: PIN; cl09128"
FT                   /db_xref="CDD:186835"
FT                   /locus_tag="Bind_3708"
FT   gene            36023..36265
FT                   /db_xref="GeneID:6198115"
FT                   /locus_tag="Bind_3709"
FT   CDS_pept        36023..36265
FT                   /locus_tag="Bind_3709"
FT                   /gene_family="HOG000057765" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: nha:Nham_2476 hypothetical protein"
FT                   /db_xref="GI:182676858"
FT                   /db_xref="GeneID:6198115"
FT                   /translation="MSRLAIAFVLALTATAANSQDTKSGQSFTPSVPRENGARPFLFDG
FT                   RMRGDGVRQGALADDHHRNAGAIVVQPTVSQPGRE"
FT                   /protein_id="YP_001831005.1"
FT   sig_peptide     36023..36082
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 20"
FT                   /locus_tag="Bind_3709"
FT   gene            complement(36323..36493)
FT                   /db_xref="GeneID:6198114"
FT                   /locus_tag="Bind_3710"
FT   CDS_pept        complement(36323..36493)
FT                   /locus_tag="Bind_3710"
FT                   /gene_family="HOG000057766" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676859"
FT                   /db_xref="GeneID:6198114"
FT                   /translation="METNMLIMSDMPFIALIVLFVIAFLFYFFVIKGVFKIIILIFKVL
FT                   SNDGRHDYDRY"
FT                   /protein_id="YP_001831006.1"
FT   gene            complement(36577..36903)
FT                   /db_xref="GeneID:6198113"
FT                   /locus_tag="Bind_3711"
FT   CDS_pept        complement(36577..36903)
FT                   /locus_tag="Bind_3711"
FT                   /gene_family="HOG000140892" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF736; KEGG:
FT                   xau:Xaut_4988 protein of unknown function DUF736"
FT                   /db_xref="GI:182676860"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="GeneID:6198113"
FT                   /translation="MSVIGSFSYDASTKIYKGRIRTLTVNVQAQLVLNDKRLSEEAPLY
FT                   RVRSSRNGAEIGAAWEKFTKDNGEAYLALKLDDPSFPAPIFGNLVEVEGEPDFQLIWSR
FT                   PNNY"
FT                   /protein_id="YP_001831007.1"
FT   misc_feature    complement(36586..36900)
FT                   /note="Protein of unknown function (DUF736); Region:
FT                   DUF736; cl02303"
FT                   /db_xref="CDD:154848"
FT                   /locus_tag="Bind_3711"
FT   gene            complement(36854..37480)
FT                   /db_xref="GeneID:6198112"
FT                   /locus_tag="Bind_3712"
FT   CDS_pept        complement(36854..37480)
FT                   /locus_tag="Bind_3712"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hsa:645586 hypothetical LOC645586"
FT                   /db_xref="GI:182676861"
FT                   /db_xref="GeneID:6198112"
FT                   /translation="MRSGDSCFARPGSRLRPKPALRTVFAFQVTIPVAAGRDRPGSSPQ
FT                   KRLAARKPRPHAPASLSPVADPALFLSGSAYALTFLRHNHLCDRPLLLAPSQAMAGLGR
FT                   GRRSFLPFPQAPSGVSPIFPSARKALRALLHSSARKNRRRGRRPRVGDTPPQKRLAPSP
FT                   PPGSPPGKGARHGRPPNIKGQISNSQELPHVSHRFFLLRRFHQDL"
FT                   /protein_id="YP_001831008.1"
FT   gene            complement(37587..38006)
FT                   /db_xref="GeneID:6198111"
FT                   /locus_tag="Bind_3713"
FT   CDS_pept        complement(37587..38006)
FT                   /locus_tag="Bind_3713"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676862"
FT                   /db_xref="GeneID:6198111"
FT                   /translation="MNTLQTIYLIALSVFTLSFDEFLYRRYLHHRKTIVDSLVYGSDDI
FT                   DPLETRLIKKLHNEVIYDQNHPLHLERIFKLSQFFFISFVIIGLIIIAFGFLIALIPFI
FT                   AINYIVYSRYCSEVTNIPMRLRKRLQILTFIHPIK"
FT                   /protein_id="YP_001831009.1"
FT   gene            complement(38096..38281)
FT                   /db_xref="GeneID:6198110"
FT                   /locus_tag="Bind_3714"
FT   CDS_pept        complement(38096..38281)
FT                   /locus_tag="Bind_3714"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676863"
FT                   /db_xref="GeneID:6198110"
FT                   /translation="MKKKTIRAPRNRATQAMRLRAASAHVAVTSDTRPKVITPRKGKGS
FT                   FCRNKPRQDDLSAMIA"
FT                   /protein_id="YP_001831010.1"
FT   gene            complement(38374..38691)
FT                   /db_xref="GeneID:6198109"
FT                   /locus_tag="Bind_3715"
FT   CDS_pept        complement(38374..38691)
FT                   /locus_tag="Bind_3715"
FT                   /gene_family="HOG000140892" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF736; KEGG:
FT                   xau:Xaut_4988 protein of unknown function DUF736"
FT                   /db_xref="GI:182676864"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="GeneID:6198109"
FT                   /translation="MATIGSFTRTQDNTLVGRINTLTIQTRATLVPIPMRTNDNAPHYR
FT                   IVTPKGVELGAAWMKTSDMGNEYLSVQLDDPSFTSTIYASLVEVEGERELQLLWSRPRR
FT                   D"
FT                   /protein_id="YP_001831011.1"
FT   misc_feature    complement(38380..38688)
FT                   /note="Protein of unknown function (DUF736); Region:
FT                   DUF736; cl02303"
FT                   /db_xref="CDD:154848"
FT                   /locus_tag="Bind_3715"
FT   gene            complement(39493..39726)
FT                   /db_xref="GeneID:6198108"
FT                   /locus_tag="Bind_3716"
FT   CDS_pept        complement(39493..39726)
FT                   /locus_tag="Bind_3716"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676865"
FT                   /db_xref="GeneID:6198108"
FT                   /translation="MKISILSEPLIFVAVTCIAILVEILPFIAVFNSSPDNPFPVLLSL
FT                   IPMISISSYKLIQHRNNNKIIARSELKPKCFT"
FT                   /protein_id="YP_001831012.1"
FT   gene            complement(39773..40366)
FT                   /db_xref="GeneID:6198107"
FT                   /locus_tag="Bind_3717"
FT   CDS_pept        complement(39773..40366)
FT                   /locus_tag="Bind_3717"
FT                   /gene_family="HOG000228656" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   tth:TTC0860 hypothetical protein"
FT                   /db_xref="GI:182676866"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="GeneID:6198107"
FT                   /translation="MNLPLRKPMTLPEFLAWEEQQPIRYEFDGSAPFAMAGGTEAHAII
FT                   QTNLAIAVGGRLRGKPCRFIGSDLKALVADNSSRYPDGMIVCSPVQNRRTTIADPVIVF
FT                   EVLSSSTASTDRIVKAREYQATPSIQRYIMLEQDRIGATIYARAGDTWTFEILSDDAIL
FT                   QMPEIGIELPLAELYEGLNFDIEDETSKEISQSS"
FT                   /protein_id="YP_001831013.1"
FT   misc_feature    complement(39848..40300)
FT                   /note="Domain of unknown function (DUF820). This family
FT                   consists of hypothetical proteins that are greatly expanded
FT                   in cyanobacteria. The proteins are found sporadically in
FT                   other bacteria. They have been predicted to belong to the
FT                   PD-(D/E)xK superfamily of...; Region: DUF820; cd06260"
FT                   /db_xref="CDD:99749"
FT                   /locus_tag="Bind_3717"
FT   misc_feature    complement(order(39998..40000,40010..40012,40052..40054,
FT                   40121..40123,40241..40243))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:99749"
FT                   /locus_tag="Bind_3717"
FT   gene            complement(40420..40791)
FT                   /db_xref="GeneID:6198106"
FT                   /locus_tag="Bind_3718"
FT   CDS_pept        complement(40420..40791)
FT                   /locus_tag="Bind_3718"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676867"
FT                   /db_xref="GeneID:6198106"
FT                   /translation="MSISFNAFHQKDNAFHFVDLPDDIELCLSSANGTDLLNTLGIEDS
FT                   CSSAPWPIEAFRALVTVARRKRLDYRSPEIPTTAHQEPGHAMVIDCGRSEGYIERRLED
FT                   LSDFLNESREAGATHIGWG"
FT                   /protein_id="YP_001831014.1"
FT   gene            complement(40861..41031)
FT                   /db_xref="GeneID:6198105"
FT                   /locus_tag="Bind_3719"
FT   CDS_pept        complement(40861..41031)
FT                   /locus_tag="Bind_3719"
FT                   /gene_family="HOG000057766" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676868"
FT                   /db_xref="GeneID:6198105"
FT                   /translation="MDANILIMLDSPFIALIVIFVLFFLFYFMVLIGIFKIIGSIVKAL
FT                   SNDRRRDYGRY"
FT                   /protein_id="YP_001831015.1"
FT   gene            complement(41112..41711)
FT                   /db_xref="GeneID:6198104"
FT                   /locus_tag="Bind_3720"
FT   CDS_pept        complement(41112..41711)
FT                   /locus_tag="Bind_3720"
FT                   /gene_family="HOG000274255" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rle:pRL80110 hypothetical protein"
FT                   /db_xref="GI:182676869"
FT                   /db_xref="GeneID:6198104"
FT                   /translation="MAFKSIDDANATLGQKPEKKRKPTTFEMVQQVAPTHSMMVKIAAA
FT                   FALEDVDYEKIRDTVQLNLMGENDALCKVLSEKALQMHLERITGAYVASAWGAANFYSN
FT                   KATEAARLSSGFGNDDRDEDRDGVAGFENKQERARQFAAEMASQAYALMAAAHGAVDAY
FT                   RHITGQDWKPYAPRAEATQRVEHRSTQAQMDAFQRR"
FT                   /protein_id="YP_001831016.1"
FT   gene            42705..43283
FT                   /db_xref="GeneID:6198103"
FT                   /locus_tag="Bind_3721"
FT   CDS_pept        42705..43283
FT                   /locus_tag="Bind_3721"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676870"
FT                   /db_xref="GeneID:6198103"
FT                   /translation="MRVEYLPGTDNVIRFPVERDERPGLALLREIAPDPREVFYAAEAF
FT                   KIAPPLHGLRGEMDRETADYILNQVDDQPGPRRQRELDGLLAPLVAKAVKLCQAHDRTS
FT                   EEIDQAYDHYDKARGKNDQASQLWMNVFEAKIVAATHLLIEAYEASERAEGAARAVAYA
FT                   MRGEPWEPFDVHKAMEKLCSLHIESKLGQ"
FT                   /protein_id="YP_001831017.1"
FT   gene            complement(43333..43887)
FT                   /db_xref="GeneID:6198102"
FT                   /locus_tag="Bind_3722"
FT   CDS_pept        complement(43333..43887)
FT                   /locus_tag="Bind_3722"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sal:Sala_2655 hypothetical protein"
FT                   /db_xref="GI:182676871"
FT                   /db_xref="GeneID:6198102"
FT                   /translation="MADYSSPTVIQQTIPEADMTELEKTVLLEIFQYEEDGNGFYLFHE
FT                   ESPQDLITIEPEDYERLLAIKDDGFSSLRTWLLENRPVGETDPTELDMSDYSYEYILQD
FT                   IVKRSKSLDYITVVTGWTCSKMRSDGFGGMASFITADEIKCHSTTQFLEDCMAEFEKDA
FT                   SPEKKQCTAEGKMPPETKATG"
FT                   /protein_id="YP_001831018.1"
FT   gene            complement(44013..44210)
FT                   /db_xref="GeneID:6198101"
FT                   /locus_tag="Bind_3723"
FT   CDS_pept        complement(44013..44210)
FT                   /locus_tag="Bind_3723"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676872"
FT                   /db_xref="GeneID:6198101"
FT                   /translation="MSDITWHDDMENCPNNVTILLKLDDGDINFTEARHNTVPWAQYYP
FT                   LKPDSGEDGVAYPVAWARVA"
FT                   /protein_id="YP_001831019.1"
FT   gene            complement(44264..44485)
FT                   /db_xref="GeneID:6198100"
FT                   /locus_tag="Bind_3724"
FT   CDS_pept        complement(44264..44485)
FT                   /locus_tag="Bind_3724"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676873"
FT                   /db_xref="GeneID:6198100"
FT                   /translation="MPKEPLSDHCSNPNHDSRWTCPACYTDLGDVGEGTITCPHCENKI
FT                   VCTLEYEPACHARLADQDDDEEEDDQRD"
FT                   /protein_id="YP_001831020.1"
FT   gene            complement(44508..44867)
FT                   /db_xref="GeneID:6198099"
FT                   /locus_tag="Bind_3725"
FT   CDS_pept        complement(44508..44867)
FT                   /locus_tag="Bind_3725"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676874"
FT                   /db_xref="GeneID:6198099"
FT                   /translation="MSTLDQYTEVKRYFSPKYRGMIVIAQEGVQLLHRLEDDDWKVLRR
FT                   KKENVLIEEWLNNRKQEMANRPAWALDVQELPSMEQLEEWLSDGQCETPTGHEVEPDGH
FT                   GPDGSPSWLLALGLI"
FT                   /protein_id="YP_001831021.1"
FT   gene            complement(44946..45140)
FT                   /db_xref="GeneID:6198098"
FT                   /locus_tag="Bind_3726"
FT   CDS_pept        complement(44946..45140)
FT                   /locus_tag="Bind_3726"
FT                   /gene_family="HOG000274207" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bbt:BBta_7714 hypothetical protein"
FT                   /db_xref="GI:182676875"
FT                   /db_xref="GeneID:6198098"
FT                   /translation="MFGTYNRLNLPVDASWQTVVRAAIKKLDPKSLKDPQLRPDRRTFY
FT                   RIMLEHHERAQEMVAAYRL"
FT                   /protein_id="YP_001831022.1"
FT   gene            complement(45116..45556)
FT                   /db_xref="GeneID:6198097"
FT                   /locus_tag="Bind_3727"
FT   CDS_pept        complement(45116..45556)
FT                   /locus_tag="Bind_3727"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676876"
FT                   /db_xref="GeneID:6198097"
FT                   /translation="MIRQYYAQRCQGGDNPLRVGTIAIGSIYYIQPTCWWRDRFRGKAE
FT                   CREPWIVEGFFNGLMGAAIKDPLTGYWENRYVSRRSDTALIRSLRTGRRRTTLVHTLIL
FT                   HDDEGLTKGPTHYPDLPRLPFRKPKSLSSKKETSPCLELTTA"
FT                   /protein_id="YP_001831023.1"
FT   gene            complement(45557..45823)
FT                   /db_xref="GeneID:6198096"
FT                   /locus_tag="Bind_3728"
FT   CDS_pept        complement(45557..45823)
FT                   /locus_tag="Bind_3728"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676877"
FT                   /db_xref="GeneID:6198096"
FT                   /translation="MTLYRLRLVEELIEGDTGEFIVEAKTPGDAASVLLTAHAEAREKD
FT                   SNHVVLPDGQSQHIEPDNIIRTRLFCMLLDDDGNELYEIDPEA"
FT                   /protein_id="YP_001831024.1"
FT   gene            complement(45858..47555)
FT                   /db_xref="GeneID:6198095"
FT                   /locus_tag="Bind_3729"
FT   CDS_pept        complement(45858..47555)
FT                   /locus_tag="Bind_3729"
FT                   /gene_family="HOG000000664" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="plasmid partitioning protein"
FT                   /transl_table="11"
FT                   /note="ParB family"
FT                   /db_xref="GI:182676878"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="GeneID:6198095"
FT                   /translation="MTNMELREVDPRILKFDSDNPRRIAADECEDAQLIASIRIVGLLQ
FT                   PPIVYENDAGLFVKVGKRRTLCSIAADLATIKVLVTEKDDDLDAMRAYMENAVRAPMSL
FT                   IDTWRAIEALAKNNWTEQAIAHGLAMTVRDVKCLRLLGQVHPPMLDHMGHGDMPKESEL
FT                   KVIALASLDDQASVWKAKKPKKGQQAFWNQIAAALQKTKFLATDARFSDEDARAFGLAW
FT                   QDDLFGPADEDNRFTNDREAFLAAQQAWLEKNLPKNGMIVEMGDYGQMKLPPKAERIWT
FT                   KPGKKDFIAFAIDQSSGRIHEQPYRMPAPVKNQNGKKAETHADDATPIPAKTKPDLTSK
FT                   GWDMIGDFRTEALHKALAENPIDDTQLIGLLVLAFSAQNVDVKTGQPYGTFKTLVGPII
FT                   QGGHLTQDPETLRQTARTMLAHVLTCKTGWNSSGLPAQLAGDAIGADAHLPSMGSEDFL
FT                   KCLSRPALEKAGSDLGVLPRDRVKDTRTAVLGQIGEAPYIHPLAHFALNDEQIAKITRP
FT                   AETYDDETDPEAEGDVNGADAEMPEHEPAGMEDDAFGHAEDDYGEEAA"
FT                   /protein_id="YP_001831025.1"
FT   misc_feature    complement(46017..47546)
FT                   /note="plasmid partitioning protein; Provisional; Region:
FT                   PRK13832"
FT                   /db_xref="CDD:184353"
FT                   /locus_tag="Bind_3729"
FT   misc_feature    complement(47268..47537)
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Bind_3729"
FT   gene            complement(47781..48119)
FT                   /db_xref="GeneID:6198094"
FT                   /locus_tag="Bind_3730"
FT                   /pseudo
FT   gene            complement(48400..48960)
FT                   /db_xref="GeneID:6198093"
FT                   /locus_tag="Bind_3731"
FT   CDS_pept        complement(48400..48960)
FT                   /locus_tag="Bind_3731"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2530 hypothetical protein"
FT                   /db_xref="GI:182676879"
FT                   /db_xref="GeneID:6198093"
FT                   /translation="MIPAAIAKALRLPALEADLFQPTQWDSPADKAAFGNALLRFLAED
FT                   CPKEKFKKPFYQRLSNCFGHIAHYNVHGFYETFFTSTADKIEFLQQTLGYPCWGDPAHT
FT                   FSDLERVVVHRIAQSGLLDWHKRTLTIETETREKAMLARLKAKYEPDPLPSKPSASTPI
FT                   VPAPIPVSTPAPPQQTTLFDLFS"
FT                   /protein_id="YP_001831026.1"
FT   gene            complement(49061..54142)
FT                   /db_xref="GeneID:6198092"
FT                   /locus_tag="Bind_3732"
FT   CDS_pept        complement(49061..54142)
FT                   /locus_tag="Bind_3732"
FT                   /gene_family="HOG000229061" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helicase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: helicase domain protein; KEGG: gox:GOX2542 DNA
FT                   methylase"
FT                   /db_xref="GI:182676880"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="GeneID:6198092"
FT                   /translation="MARSRKDSFQLSLFDTTALSPAFTARPTVKTPASATPVPSEISPL
FT                   AHETEPFPARDFRLEGDRGLAKGWKARAADNLKAIALSQKLAEEGRNASPEEQAILARF
FT                   TAFGAGEVADKIFRRLDSPLVPGWETLTEDLEQLVTQTELASLKRVTQYAHYTPERLVS
FT                   ALWKGVRHLGFAGGKVLEPGCGTGLFFALMPEKLRQKVSLTGIEMDPVTARITGQLFPN
FT                   AWIRNEDFTKAKLPDSYDLAIGNPPFSDRTVHGDDATGKLNLSLHDYFIARSIDRLKPG
FT                   SLAAFVTSRYTLDKTSTMARDAIAQSADLVAAFRLPRGAMAESAGTDVILDVLFFHKRL
FT                   TGQEPNGITWKNLAEVLPVEDGEAALSINEYYLAHPEHVLGRHARVSSQYGPTYGCMPA
FT                   DGDLFDRFDALIDTLPQNLVQATEASQERPSSPKPRVVVGTAAEGATIKEGSYLLLDDE
FT                   LHQIIDGEPRKVAIRSATNKEGIFAKHARIIRALIPVRDAVRAVLRAQEADQPWGVAQS
FT                   RLRAAYQAFVRQFKPINLTNVTETTDPKTGAIRETQRRPNLQPFLDDPDVWLVSSIENY
FT                   SIETGEAKQGPIFTERVLHPPVEPMVQSAADALAVCLHERGTIDLPTIGELLGQSEDQV
FT                   IEALRGQIYRIPSTVPGLDVWQSADAYLSGNVRRKLVEAKTHAETDFRYRANVQALEAV
FT                   QPADLKPSDITVRLGASWIPVSDIVRFIRETMEIETTIHHIPELAIWTIDESPFQGQAA
FT                   ATSVWGTERAPAGELLSDALNARIPEIKDIITEDGRKTEVVNAVETEAAREKLAKIRDA
FT                   FSAWVWTDTERAERLCRLYNDTFNNLVPRHFDGSHLRLPGASSVINFHFHQKRVIWRII
FT                   SAGKTYIAHAVGAGKTFSMAAAIMEQKRLGLITKAMYAVPGHCLAQAAREFLLLYPTAQ
FT                   ILVADETNFTKDKRQRFLARAATGHWDAIIITHSAFKLIAAPAAFEQRLIEDQINTYQS
FT                   LLESVDKSERITRKRIEDRKECFEKQLKELQSTKDDLLTIGEIGVDQIIVDEAQEFRKL
FT                   SFPTNMSSLKGVDPKGSQRAWDLYAKARYIETINAGRELIMASGTPITNTLGEMYTLQR
FT                   YMQPEALAERRVSEFDAWAANFGETRTELELQPSGQYKPVTRFSEFVNVADLMAIYRTI
FT                   ADVVLKSDLRKHLKLPAIRGGRREIITSEASSAFKAYQNYLARRIKTIEDRHSKPQKGD
FT                   DILLSVITDGRHAAIDLRFVGLKYGEPGNKLNKLIDNAFAIWLETKDWTYRQPDGTPWP
FT                   LPGAAQMIFSDLGTPNAAAKRGFSAYTWIRDQLIARGVPASEIAFMQDYKKSSAKQRLF
FT                   NDVNAGKVRFLIGSTQTMGTGVNAQQRLIALHHLDVPWLPSDIEQREGRIERQGNQNAE
FT                   IRLFAYVAKGSVDATGWQLLERKARFIDMAMSGDRSIRRIEDVGSTVDQFAFAKALASG
FT                   DERLMRKAGLEAEVARLERLANAHFDDQIAVRHEITRNEKTLERAKKQITALQNDLATR
FT                   RATKGDLFEMQVRDRPYRERKDAGGALLKAMAEKIAAGSNGHWTLARIGGFNVSIGLRF
FT                   YKIGDYRLDGALLREADDVEIDLTGDLTPLGVIARLEHALSSFDGELRSWQAKAAEAEH
FT                   RLPGYRARLGETFAHQADLDDKHQDLAELEALLQLTPAEKAEEEDIGWSQYLCAA"
FT                   /protein_id="YP_001831027.1"
FT   misc_feature    complement(53138..53974)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:187159"
FT                   /locus_tag="Bind_3732"
FT   misc_feature    complement(51395..53041)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="Bind_3732"
FT   misc_feature    complement(50408..>51031)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="Bind_3732"
FT   misc_feature    complement(49952..>50128)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="Bind_3732"
FT   gene            complement(54228..54620)
FT                   /db_xref="GeneID:6198090"
FT                   /locus_tag="Bind_3733"
FT   CDS_pept        complement(54228..54620)
FT                   /locus_tag="Bind_3733"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676881"
FT                   /db_xref="GeneID:6198090"
FT                   /translation="MSAVKKPLDRGQSHKRDILPLPLPPAPQYLGTWSWRDPQPGETIR
FT                   QWRDRADRLRAELEGRAANWCAPGQRVRIVHDPRTFEPWIEERIGTIIKRCGEPFTDYA
FT                   RVAIDLIGRETKVRLHLLPLETIEPF"
FT                   /protein_id="YP_001831028.1"
FT   gene            complement(54624..54950)
FT                   /db_xref="GeneID:6198089"
FT                   /locus_tag="Bind_3734"
FT   CDS_pept        complement(54624..54950)
FT                   /locus_tag="Bind_3734"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676882"
FT                   /db_xref="GeneID:6198089"
FT                   /translation="MKERVAQPNPEQPTSSPPEAKLSSLFQHFNHEAARREGWDLIAEG
FT                   HYADGDAKIQIQTTRGTSPFREDRDAWKHVVDEARKYSQLHRDALDLIDRREQMAIFTV
FT                   HGFW"
FT                   /protein_id="YP_001831029.1"
FT   gene            complement(55225..55566)
FT                   /db_xref="GeneID:6198088"
FT                   /locus_tag="Bind_3735"
FT   CDS_pept        complement(55225..55566)
FT                   /locus_tag="Bind_3735"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676883"
FT                   /db_xref="GeneID:6198088"
FT                   /translation="MAKYIITAHKIDAITVSKASGFTSTQMSSLFGAKPEKTVDVSSLK
FT                   ELIAEYNAFADSFKDSGICYQLYACKHPQETARLFSGFNKAITKDGPLKRVINRDIAIA
FT                   AGEKEQASA"
FT                   /protein_id="YP_001831030.1"
FT   gene            complement(55665..55952)
FT                   /db_xref="GeneID:6198087"
FT                   /locus_tag="Bind_3736"
FT   CDS_pept        complement(55665..55952)
FT                   /locus_tag="Bind_3736"
FT                   /gene_family="HOG000057755" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676884"
FT                   /db_xref="GeneID:6198087"
FT                   /translation="MADGTILPTDIVKSLGDFSIIAKMHPIGPTDQDQDRRRANAQLFI
FT                   ASRDMALLLEEAFTAYSAEFENDQDISGADFLEWFANWRQRVKRLTQSLP"
FT                   /protein_id="YP_001831031.1"
FT   gene            complement(56028..56567)
FT                   /db_xref="GeneID:6198086"
FT                   /locus_tag="Bind_3737"
FT   CDS_pept        complement(56028..56567)
FT                   /locus_tag="Bind_3737"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dol:Dole_3186 CO dehydrogenase/acetyl-CoA
FT                   synthase delta subunit"
FT                   /db_xref="GI:182676885"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="GeneID:6198086"
FT                   /translation="MNSILVLPHALTPEPLGQKLLQLVVSLVSRRAAERVRIEPQAPAK
FT                   AALQAAAKNAPKAVPKTVPQAAKAVPVIPLRPFKAPTINAFDLASHPDEAVSDKAIELL
FT                   LGRGSSSVNDVLDDLLPRTERNATEKALDLKVARAIILHVVAIEIRHIAQMTGLSEATI
FT                   LAIVDAWQNEALEKAA"
FT                   /protein_id="YP_001831032.1"
FT   gene            complement(56800..56949)
FT                   /db_xref="GeneID:6198085"
FT                   /locus_tag="Bind_3738"
FT   CDS_pept        complement(56800..56949)
FT                   /locus_tag="Bind_3738"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676886"
FT                   /db_xref="GeneID:6198085"
FT                   /translation="MNKDLAAAIEKSNASFEKTVREQTCWLSTVVFAAVGVFATLVGIL
FT                   IHFK"
FT                   /protein_id="YP_001831033.1"
FT   gene            complement(56984..57118)
FT                   /db_xref="GeneID:6198084"
FT                   /locus_tag="Bind_3739"
FT   CDS_pept        complement(56984..57118)
FT                   /locus_tag="Bind_3739"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676887"
FT                   /db_xref="GeneID:6198084"
FT                   /translation="MDSLKRVINRDIALMIDTLSITKMLKEAGFSESQATALARAIDK"
FT                   /protein_id="YP_001831034.1"
FT   gene            complement(57207..57479)
FT                   /db_xref="GeneID:6198083"
FT                   /locus_tag="Bind_3740"
FT   CDS_pept        complement(57207..57479)
FT                   /locus_tag="Bind_3740"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676888"
FT                   /db_xref="GeneID:6198083"
FT                   /translation="MELVRIIITIVFVRIVFQRFTSMKRGNTFPPTPFRNSAVAAHFGF
FT                   RIIAQVYTPFTSGKTRFCVQLQPGRSCNIREELLRPSRRLLRRWL"
FT                   /protein_id="YP_001831035.1"
FT   gene            complement(57681..57950)
FT                   /db_xref="GeneID:6198082"
FT                   /locus_tag="Bind_3741"
FT   CDS_pept        complement(57681..57950)
FT                   /locus_tag="Bind_3741"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676889"
FT                   /db_xref="GeneID:6198082"
FT                   /translation="MSPDPKATRPFIAVEPLLQDALYSIAGDALSKILDEDILPVPSQL
FT                   GQVCMICGCSEEDACTTDSANCSWATPNLCSACASTTHTTHTDD"
FT                   /protein_id="YP_001831036.1"
FT   gene            complement(57956..58713)
FT                   /db_xref="GeneID:6198081"
FT                   /locus_tag="Bind_3742"
FT                   /pseudo
FT   gene            complement(58763..58933)
FT                   /db_xref="GeneID:6198080"
FT                   /locus_tag="Bind_3743"
FT   CDS_pept        complement(58763..58933)
FT                   /locus_tag="Bind_3743"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676890"
FT                   /db_xref="GeneID:6198080"
FT                   /translation="MKESTPMTQRFSSRFNGREAFVQLPQDVQIEIGGLALELILAWNG
FT                   QDAYDDPRVKT"
FT                   /protein_id="YP_001831037.1"
FT   gene            complement(58930..59292)
FT                   /db_xref="GeneID:6198079"
FT                   /locus_tag="Bind_3744"
FT   CDS_pept        complement(58930..59292)
FT                   /locus_tag="Bind_3744"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: nha:Nham_2399 hypothetical protein"
FT                   /db_xref="GI:182676891"
FT                   /db_xref="GeneID:6198079"
FT                   /translation="MTEAVKHRFPNRRESTSIPFEAEGVHWIVSYSRLPNDKVGEFFIA
FT                   CNKPGSKIEANIRDAVIGVSIGLQYGMPLEVVHAAMNADEDGSPASVVGRAIALVIDDM
FT                   QSHAEEQILLASQAAE"
FT                   /protein_id="YP_001831038.1"
FT   misc_feature    complement(59065..>59283)
FT                   /note="vitamin B12-dependent ribonucleotide reductase;
FT                   Validated; Region: PRK06556"
FT                   /db_xref="CDD:180621"
FT                   /locus_tag="Bind_3744"
FT   gene            complement(59289..59495)
FT                   /db_xref="GeneID:6198078"
FT                   /locus_tag="Bind_3745"
FT   CDS_pept        complement(59289..59495)
FT                   /locus_tag="Bind_3745"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676892"
FT                   /db_xref="GeneID:6198078"
FT                   /translation="MPDLFSKTPRHDADTTVETPRTERQLQAHTCLICGKPAHFGFGVS
FT                   LLHGIEGRWSCFSHREDVKRRKE"
FT                   /protein_id="YP_001831039.1"
FT   gene            complement(59506..61698)
FT                   /db_xref="GeneID:6198077"
FT                   /locus_tag="Bind_3746"
FT   CDS_pept        complement(59506..61698)
FT                   /locus_tag="Bind_3746"
FT                   /gene_family="HOG000033016" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UvrD/REP helicase"
FT                   /transl_table="11"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: gox:GOX2523 DNA
FT                   helicase II UvrD"
FT                   /db_xref="GI:182676893"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="GeneID:6198077"
FT                   /translation="MKTSTISTAPSPCFLSTASLPASSSQFMDGIAMSNEFDHYDPDAY
FT                   ASFMDDRPMYAPSSEAFTVLTQGLTPRQIEAASAPGAVVVLAGAGTGKTSTLTCAVVHR
FT                   IAVEGLSASRILAVTFTNKAASEMSDRIRAALQGGSTPSWLGTFHGLGARQLRAEPEVA
FT                   GLRPNFEILDADDSRRLIKRIMQSLNLNTDEQDNESGPEPIKRMINQISKFKDLLLSPD
FT                   EAPAYVQKKIAEANAIGEPIHPASLFNAARIYALYQQRLRDQNSADFGDLLLWPTRALL
FT                   RDAAYRTRWARRFDCILADEYQDVNYAQYQWLRALAFEHHRIFCVGDDDQAIYGWRGAD
FT                   ITYIRRFTQDFPQASVIRLEENFRSTGAILASANAVIARDPHRLGKTLFTNKGYGQPIE
FT                   VVAYRYCDGEAHGIVEEIKKRHAEGVDFAEMAILYRNNFFSRGFEECLVRAKIPYVIVG
FT                   DVGFYQRAEIKDTLAFLRIATTPDDRQSDEALRRVINEPRRGFGKKAMAILEEEANFRH
FT                   LSLFRAIETATLSSACRKAGLMFVAAIEKVAKDPSLTLADQLSLLLDATGYRAMLQASK
FT                   AEDGKARLENISELLHLAGSFHDAHELLDHAALASSRPNENEEGRLKLMTLHKSKGLEF
FT                   EHVFLPGWEDGIFPAGNSDLDEERRLAYVAITRAKRRAAITYCEYRRGLADPSSFIADI
FT                   PPQHRIEGWLRDDGLPPVQRERKANAWHNPRRARSF"
FT                   /protein_id="YP_001831040.1"
FT   sig_peptide     complement(61624..61698)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.968 at
FT                   residue 25"
FT                   /locus_tag="Bind_3746"
FT   misc_feature    complement(59605..61428)
FT                   /note="Superfamily I DNA and RNA helicases [DNA
FT                   replication, recombination, and repair]; Region: UvrD;
FT                   COG0210"
FT                   /db_xref="CDD:30559"
FT                   /locus_tag="Bind_3746"
FT   misc_feature    complement(60049..61428)
FT                   /note="UvrD/REP helicase; Region: UvrD-helicase; cl14126"
FT                   /db_xref="CDD:187234"
FT                   /locus_tag="Bind_3746"
FT   gene            complement(61878..62198)
FT                   /db_xref="GeneID:6198076"
FT                   /locus_tag="Bind_3747"
FT   CDS_pept        complement(61878..62198)
FT                   /locus_tag="Bind_3747"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676894"
FT                   /db_xref="GeneID:6198076"
FT                   /translation="MTTALMPSATANDNLHDRHSIAFVRLPEGTSLQPTWRSNQSSLTD
FT                   TYVFVEPHDGSGAIEGLVISGDQDADGDWILETAFTVLVTSDNHLDELLCVYPWNCHVE
FT                   TL"
FT                   /protein_id="YP_001831041.1"
FT   gene            complement(62195..63139)
FT                   /db_xref="GeneID:6198075"
FT                   /locus_tag="Bind_3748"
FT   CDS_pept        complement(62195..63139)
FT                   /locus_tag="Bind_3748"
FT                   /gene_family="HOG000274248" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2525 hypothetical protein"
FT                   /db_xref="GI:182676895"
FT                   /db_xref="GeneID:6198075"
FT                   /translation="MSRDPELMHFREHIHCGLVLERVGEPWTLDKAESTRNALKYRRGK
FT                   GETLIVNHDGKGWWDPHSDVKGDVISLVQYLKPGTNLGLVRKILRPLARVEFSSSLPSP
FT                   ERPAKVKDDNRPVSWRWNRRPELWPGSKGWRYLTEERGLPAAILNSAIRADVVRYGRVG
FT                   SAWFAHRDERGTVCHIDVRGPDYKGGLTGGRKTLFRFGTTDIPRRLVLTEAAIDALSLA
FT                   AMHGERDDTLYAATSGGMGPHTLTALKSLLTQMAERYSDPVLISAVDANPAGARYAGIH
FT                   AILAAEAGVRFERLRPPIEGGDWNQVLQNRSRP"
FT                   /protein_id="YP_001831042.1"
FT   gene            complement(63136..63528)
FT                   /db_xref="GeneID:6198074"
FT                   /locus_tag="Bind_3749"
FT   CDS_pept        complement(63136..63528)
FT                   /locus_tag="Bind_3749"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rno:684340 hypothetical protein"
FT                   /db_xref="GI:182676896"
FT                   /db_xref="GeneID:6198074"
FT                   /translation="MLKTKSQAPRGGAVKPIKKRKRKSRKNRRGHAFSRERLVKSIRSI
FT                   MEVSISQPSSHPKRSSASVLSLTKKGLGLRPRRAPACLPPSFLRAARSVQPVPREATRS
FT                   ACTPATRREAGVQAGLNPGQKRGESR"
FT                   /protein_id="YP_001831043.1"
FT   gene            63770..64204
FT                   /db_xref="GeneID:6198073"
FT                   /locus_tag="Bind_3750"
FT   CDS_pept        63770..64204
FT                   /locus_tag="Bind_3750"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: nar:Saro_3916 WGR domain protein"
FT                   /db_xref="GI:182676897"
FT                   /db_xref="GeneID:6198073"
FT                   /translation="MEELAILLEARAPDLNRHRFWRVRIDRDLFGCWNARVTFGRIGGA
FT                   GRTLRYDFEDQDEARAFVRKGLKRRQGAPRRCGVAYRLVEASGNAEDLLSREIWAPACE
FT                   PPTPSRPALPPSGPKPGALLSPALAPTLWDWLRARSKSGS"
FT                   /protein_id="YP_001831044.1"
FT   misc_feature    63782..63982
FT                   /note="WGR domain of molybdate metabolism regulator and
FT                   related proteins; Region: WGR_MMR_like; cd07996"
FT                   /db_xref="CDD:153425"
FT                   /locus_tag="Bind_3750"
FT   gene            64255..64704
FT                   /db_xref="GeneID:6198072"
FT                   /locus_tag="Bind_3751"
FT   CDS_pept        64255..64704
FT                   /locus_tag="Bind_3751"
FT                   /gene_family="HOG000232166" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase S24/S26 domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase S24 and S26 domain protein; KEGG:
FT                   mex:Mext_0361 peptidase S24 and S26 domain protein"
FT                   /db_xref="GI:182676898"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="GeneID:6198072"
FT                   /translation="MFSFRSFHPLRVRRGARRPLPYFLEGLCAGFPSPADDYLDESIDL
FT                   NDLLIRNQPATFLWRVDGHSMREAGIFHGDLLVVDRSLAPADGDIVVVIVNGERSLKRL
FT                   QIRKGQLTLSFENKDYPEGLALHEGDEIEIWGVVRCSIHWHRAGG"
FT                   /protein_id="YP_001831045.1"
FT   misc_feature    <64255..>64425
FT                   /note="Helicase; Region: Herpes_Helicase; pfam02689"
FT                   /db_xref="CDD:145705"
FT                   /locus_tag="Bind_3751"
FT   misc_feature    64423..64668
FT                   /note="Peptidase S24 LexA-like proteins are involved in the
FT                   SOS response leading to the repair of single-stranded DNA
FT                   within the bacterial cell. This family includes: the lambda
FT                   repressor CI/C2 family and related bacterial prophage
FT                   repressor proteins; LexA (...; Region: S24_LexA-like;
FT                   cd06529"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="Bind_3751"
FT   misc_feature    order(64447..64449,64558..64560)
FT                   /note="Catalytic site; other site"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="Bind_3751"
FT   gene            64704..65966
FT                   /db_xref="GeneID:6198071"
FT                   /locus_tag="Bind_3752"
FT   CDS_pept        64704..65966
FT                   /locus_tag="Bind_3752"
FT                   /gene_family="HOG000252172" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   mex:Mext_3517 DNA-directed DNA polymerase"
FT                   /db_xref="GI:182676899"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="GeneID:6198071"
FT                   /translation="MSRIFALIDANSFYGSCERLFDPSLAKRPVIVLSNNDGCAVSRTS
FT                   DAKPFVAMGQPYFQIKDVCRRENIAVFSSNYSLYGDVSARLNQVYRQFSPEIEVYSIDE
FT                   SFLDFSGFGDRNLEAYARELHETIFRWVGIPTCVGIAPTKTLAKLANRVAKSSPDLGGV
FT                   CDLRDQGKREEVLKRVPVEDVWGIGRASAAKLQRLGVITAADLAALPSPFARKLLSVVG
FT                   ERIVHELQGQPCLLLEQVAPQRKGCAVTRSFSARVTELDQMLEAVSAYAVQLGEKLRHH
FT                   SLATEALTVFYHTSPFDTGPQRSVQKCVTLPEASADTLTLLRAARDGARAIWKEGYRYA
FT                   KAGLVTMDLVRLEDAPRALFDAYDREASARLMMALDAVNAKFGRGTLHPAAAGIKRPWS
FT                   TQFNMRSPRYTTCLDELPLVF"
FT                   /transl_table="11"
FT                   /protein_id="YP_001831046.1"
FT   misc_feature    64713..65960
FT                   /note="DNA polymerase V subunit UmuC; Reviewed; Region:
FT                   umuC; PRK03609"
FT                   /db_xref="CDD:179607"
FT                   /locus_tag="Bind_3752"
FT   misc_feature    64719..65747
FT                   /note="umuC subunit of DNA Polymerase V; Region:
FT                   PolY_Pol_V_umuC; cd01700"
FT                   /db_xref="CDD:176454"
FT                   /locus_tag="Bind_3752"
FT   misc_feature    order(64728..64733,64740..64745,64836..64838,64845..64847,
FT                   65010..65015,65166..65168)
FT                   /note="active site"
FT                   /db_xref="CDD:176454"
FT                   /locus_tag="Bind_3752"
FT   misc_feature    order(65004..65006,65013..65015,65256..65276,65361..65363,
FT                   65436..65453,65532..65534,65589..65603,65607..65609)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:176454"
FT                   /locus_tag="Bind_3752"
FT   gene            complement(66033..66743)
FT                   /db_xref="GeneID:6198070"
FT                   /locus_tag="Bind_3753"
FT   CDS_pept        complement(66033..66743)
FT                   /locus_tag="Bind_3753"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676900"
FT                   /db_xref="GeneID:6198070"
FT                   /translation="MTAPRTRTKSALKEFLADEEDVPVFDQRATEFASHIVVDGSLLDS
FT                   IREIFAGTPVATDDVRLQQILDVRAEVQKNWSDARDSFLSIGRALLSLESILSKLEYQK
FT                   LRYGTDRIFPFSDATATQFRQIARAVDSGRIPYDRCPGSYGTAYQITLLDDYQLKVANE
FT                   RDLIRPNVTRREISLLRQEIKYQAATPGRIDRSVLQEERNNLRKKQQRLQIELEQVATR
FT                   LSELESLLGDITAE"
FT                   /protein_id="YP_001831047.1"
FT   gene            complement(66740..67384)
FT                   /db_xref="GeneID:6198069"
FT                   /locus_tag="Bind_3754"
FT   CDS_pept        complement(66740..67384)
FT                   /locus_tag="Bind_3754"
FT                   /gene_family="HOG000057767" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pla:Plav_0032 cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="GI:182676901"
FT                   /db_xref="GeneID:6198069"
FT                   /translation="MTKILLVSSPKGGSGKSVLARHLMVSAAQDGISVLGVDYDRQSTF
FT                   CKWGERRKATRVKFPEFVDAEVVHGDLKNWRSSIADGKEKSLLIVDTPPSVEDHLAAIT
FT                   QLSSQSDMILVPAVCTQDDMDSVAPWIQVMIEHNKNAVIVLNRANRRTTSFARVRGRLI
FT                   KLAEVCPVEIPQLEDVHVPSSKGLTLLDYTKSKGQASFEEIWAFVRRRLGL"
FT                   /protein_id="YP_001831048.1"
FT   misc_feature    complement(66749..>67126)
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="Bind_3754"
FT   gene            67695..68208
FT                   /db_xref="GeneID:6198068"
FT                   /locus_tag="Bind_3755"
FT                   /pseudo
FT   gene            complement(68433..68651)
FT                   /db_xref="GeneID:6198067"
FT                   /locus_tag="Bind_3756"
FT                   /pseudo
FT   gene            68746..69681
FT                   /db_xref="GeneID:6198066"
FT                   /locus_tag="Bind_3757"
FT                   /pseudo
FT   gene            69815..70114
FT                   /db_xref="GeneID:6198065"
FT                   /locus_tag="Bind_3758"
FT   CDS_pept        69815..70114
FT                   /locus_tag="Bind_3758"
FT                   /gene_family="HOG000008424" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="addiction module antitoxin"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: addiction module antitoxin, RelB/DinJ
FT                   family; PFAM: RelB antitoxin; KEGG: xau:Xaut_4999 addiction
FT                   module antitoxin, RelB/DinJ family"
FT                   /db_xref="GI:182676902"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="GeneID:6198065"
FT                   /translation="MATQTSMLHIRVDDQLKAQATEKLANVGLTVSDAVRILLTRIAKE
FT                   GGLPAGLTTEPEAYDAWFRAKVHEAIADPRPAIPHQQVMDEMQFLIDRKRRARS"
FT                   /protein_id="YP_001831049.1"
FT   misc_feature    69815..>69961
FT                   /note="RelB antitoxin; Region: RelB; cl01171"
FT                   /db_xref="CDD:186367"
FT                   /locus_tag="Bind_3758"
FT   gene            70152..70391
FT                   /db_xref="GeneID:6198064"
FT                   /locus_tag="Bind_3759"
FT   CDS_pept        70152..70391
FT                   /locus_tag="Bind_3759"
FT                   /gene_family="HOG000138822" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="plasmid stabilization system protein"
FT                   /transl_table="11"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   ajs:Ajs_2238 addiction module toxin, RelE/StbE family"
FT                   /db_xref="GI:182676903"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="GeneID:6198064"
FT                   /translation="MDYISDDNPDAAQRLKDDIETKVSKLPDYPKLYREGRVIGTREMV
FT                   VRSNYVIVYTEDARAVTILRVLHAAQQWPPIGEE"
FT                   /protein_id="YP_001831050.1"
FT   misc_feature    70155..70388
FT                   /note="Plasmid stabilisation system protein; Region:
FT                   Plasmid_stabil; cl11422"
FT                   /db_xref="CDD:164217"
FT                   /locus_tag="Bind_3759"
FT   gene            70588..70944
FT                   /db_xref="GeneID:6198063"
FT                   /locus_tag="Bind_3760"
FT   CDS_pept        70588..70944
FT                   /locus_tag="Bind_3760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676904"
FT                   /db_xref="GeneID:6198063"
FT                   /translation="MEENRHWKGSIFSTIRSSRENDSDTSGVRFTKGSISNCYRTFDIY
FT                   LLAEILRPGIIRLCLPEDRSAQDWLNFSTGDITSKKQFESFLTWHPRRFTTQPDISDDC
FT                   HMTPSSIETINFTP"
FT                   /protein_id="YP_001831051.1"
FT   gene            complement(71052..71810)
FT                   /db_xref="GeneID:6198062"
FT                   /locus_tag="Bind_3761"
FT                   /pseudo
FT   gene            complement(71869..73326)
FT                   /db_xref="GeneID:6198061"
FT                   /locus_tag="Bind_3762"
FT   CDS_pept        complement(71869..73326)
FT                   /locus_tag="Bind_3762"
FT                   /gene_family="HOG000001437" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mlo:mlr6204 hypothetical protein"
FT                   /db_xref="GI:182676905"
FT                   /db_xref="GeneID:6198061"
FT                   /translation="MKFESQIFDEPLLEFGDQHSHPDPRLGLTEAGPLQVPLGDKIRVG
FT                   VVGDARTVGSAKQFLAKAADGIESTADSHPNMNPHFPGLQNNNPFRCQFVIEDEATATL
FT                   SKAQIDKIRKEPNHAKAVEMAVDAVVDLLQVLDDSGDRPDVALVALPVALIERVWNAKI
FT                   DAEGTTEKDDSGGSDAPNFRGLLKAKAMSLNFPIQILWEDVIDEKAKIPRKVKVSSERK
FT                   IQDEAGRSWNLLTTLYYKGSGRIPWRRLPKEGEFRACYIGISFYRDVSGQQLWTSAAQM
FT                   FDERGRGFILKGKRAQTESRGRHPYMTEEDAYELVKGALKAYRDHHKHSPARVIILKTS
FT                   RFRDDEADGILRALEEAETELRDLVWVQESYDAKILRDGDYPVLRGTFVDLDGKGLLYT
FT                   NGSIPYYGTYPGLYVPRPLLLCPHPSSDSTAAQIAEEVFSLTKINWNSTQMNQRLPVPI
FT                   RAARKVGEVLKYIPDGQSISSDYRRYI"
FT                   /protein_id="YP_001831052.1"
FT   misc_feature    complement(71911..73296)
FT                   /note="Piwi_piwi-like_ProArk: PIWI domain, Piwi-like
FT                   subfamily found in Archaea and Bacteria. RNA silencing
FT                   refers to a group of related gene-silencing mechanisms
FT                   mediated by short RNA molecules, including siRNAs, miRNAs,
FT                   and heterochromatin-related guide...; Region:
FT                   Piwi_piwi-like_ProArk; cd04659"
FT                   /db_xref="CDD:72944"
FT                   /locus_tag="Bind_3762"
FT   misc_feature    complement(order(71989..71991,72607..72609,72619..72621,
FT                   72631..72633,72640..72642,72715..72717,72724..72735,
FT                   72766..72768,72778..72780))
FT                   /note="5' RNA guide strand anchoring site; other site"
FT                   /db_xref="CDD:72944"
FT                   /locus_tag="Bind_3762"
FT   misc_feature    complement(order(71941..71943,72310..72312,72529..72531,
FT                   72535..72537))
FT                   /note="active site"
FT                   /db_xref="CDD:72944"
FT                   /locus_tag="Bind_3762"
FT   gene            complement(73316..74650)
FT                   /db_xref="GeneID:6198060"
FT                   /locus_tag="Bind_3763"
FT   CDS_pept        complement(73316..74650)
FT                   /locus_tag="Bind_3763"
FT                   /gene_family="HOG000004228" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mlo:mlr6203 hypothetical protein"
FT                   /db_xref="GI:182676906"
FT                   /db_xref="GeneID:6198060"
FT                   /translation="MAKKITDSQLIGELGEAAVRKRFLSMGFQFDLRGRLEAGIDGIAE
FT                   IMIEGEPTARMIAVQVKSTRAGTYTSETDSGFSYLLNSKDLYYWRTSNLPVILVLYRES
FT                   DETLFWRPISSQPGVEQRRVTFDKATDALDKAAVDRLAQLTVPKNGFGYYVPPLGGGET
FT                   ALVNLLPIVLPTEMFVASTPLDSKRAIAKLHDQDDPTRFDWTIKGGTFWSFHDPREAVT
FT                   SAIVDLDQVEAIETCLLAFHEDIDEQHNFAFLLRQTLQHQMRDDLAWDKEGKLFYIRAL
FT                   HENQGRTFHYQSAKNKTHADVVTVAMQPKDPQKVSYVRHHAFVPKFEGMLDQWFLMVSP
FT                   TYHFTTNGFHRHSHPHALLSGKKRLDNNASLRGQLIMWHRLLSLRDQEQSGLFASEDDG
FT                   EPPILRFEAPPEIDLPTTVPEDAWGKPKTKIEEPDNQVGLLFDEV"
FT                   /protein_id="YP_001831053.1"
FT   gene            74987..75784
FT                   /db_xref="GeneID:6198059"
FT                   /locus_tag="Bind_3764"
FT   CDS_pept        74987..75784
FT                   /locus_tag="Bind_3764"
FT                   /gene_family="HOG000055100" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: nha:Nham_1149 hypothetical protein"
FT                   /db_xref="GI:182676907"
FT                   /db_xref="GeneID:6198059"
FT                   /translation="MTLTLVPIDHGELCHGWTWNINDEDMLAERVARIVLGQYRHVAKI
FT                   LSGAGVPGPVANTEQANAAIKQLTLAEGDDPWHRDGWLFQAISWIAAHQQPSASLTRMP
FT                   HIRKADKGFDGIQLELNEAGTAVIAVVVFEDKATDKARDTIRDDVWPGIVALEKGERLN
FT                   ELSQEVSGMLDARAAADPEFDLDTAIANTLWHNARRYRVSITIGNTHNNADARAKLFKG
FT                   FDNSAPGPASRRRADTIYLPEMRNWMASFAACVILKIKAIANV"
FT                   /protein_id="YP_001831054.1"
FT   gene            75777..79088
FT                   /db_xref="GeneID:6198058"
FT                   /locus_tag="Bind_3765"
FT   CDS_pept        75777..79088
FT                   /locus_tag="Bind_3765"
FT                   /gene_family="HOG000055101" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helicase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; KEGG: fjo:Fjoh_3576 DEAD/DEAH box
FT                   helicase domain protein"
FT                   /db_xref="GI:182676908"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="GeneID:6198058"
FT                   /translation="MFDPTTAALIRAAPPLEGLDLDNLPKRLTEAFADIVSARIRLRGA
FT                   PAEADDEALLTTVAELRRIAAAHETYAALLPDRENRASAAFVAASAHQAVSLALRGAEA
FT                   TSQVDMSAVSPDICATLLFLLAEAHADAADAAKRIVPTADAGPIERALLLAIRSLAQGR
FT                   LGEIVDADEPEIDVDGDDLGFRALDALRLLLLRGVTNLARQLRLRVDLAPEVGGIVPSS
FT                   ALFAQVRVLASEPIDGAGVAGETLLSLYPGPLHLANLLLGLEGDLLGTALSRIPTPGGV
FT                   DDNEWWQTLRRMARQRPYLWRNHREAIDKGYLEQGVSSAISFPTGGGKSTLAELKIATA
FT                   LLRGERVIFLAPTHALVGQTQRSLKGTFQDYSILADVNEDVGFGDVVMLGEVTAMTPER
FT                   CLMLLSVDPDAFADLGLIVFDECHLLHPREEDRSRRGLDAMLAILNLTRIAPSSDLLLL
FT                   SAMMKNTQEIAGWVAFLTGRQCLTLDLSWKPTRQVRGCVVYPAEQITALKAVLAQAHID
FT                   YPKYDSPPVEVKNVLLAQPFGLFSLLQTWSTTDRSDYALLQLLADCHLLSSGRAKGGNW
FT                   YLTPNGNETSGAIAAAAASAGMKTLVFVQTTVFCESCVKNYPARVAASQITLTEEEQKW
FT                   RTLAEEEMGGAGYCYMKLAADGTLRTGAASHHALLLREERELHESLFRRPEGIKVLFAT
FT                   STLAQGMNLPSEVVIISGDSRFDPQADKMQKLEAHELLNAAGRAGRAGEGAQGFVLLVP
FT                   SKVIDFDDQNNQINGHWMDLQAIFEQADQCLVIDDPLKVVLDRIHDGVTQTGASAYLLS
FT                   KLPLAVAGAEVDPAAVLLNRSFSAYRALMAADTDWLSTRVASALAARAALELPEPDRWI
FT                   EQVSGATGLSVALLQQIVERLDAGAFSGSALEVVAALLDWLDAHPSQLLSLVRPESLEE
FT                   MFGTPYKNLADHEARGKHALFWLRKLWPIWMSGVPLCELEKAFLGRTTKLKQCKNARHF
FT                   ASRLVPDLAFLAGLPGRLLAARLRAVEDETPVSSVLASLSGVVREGCDSPDSLALRLHL
FT                   TRSVSRVAARKHYDAIRQHIQPGNPNEGFEETLERIRHADVVASFDDLDNLDGDG"
FT                   /protein_id="YP_001831055.1"
FT   misc_feature    76746..77156
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Bind_3765"
FT   misc_feature    76752..76766
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Bind_3765"
FT   misc_feature    77034..77045
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Bind_3765"
FT   misc_feature    <77574..>77930
FT                   /note="Superfamily II helicase [General function prediction
FT                   only]; Region: COG1204"
FT                   /db_xref="CDD:31397"
FT                   /locus_tag="Bind_3765"
FT   gene            complement(79470..79715)
FT                   /db_xref="GeneID:6198057"
FT                   /locus_tag="Bind_3766"
FT   CDS_pept        complement(79470..79715)
FT                   /locus_tag="Bind_3766"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676909"
FT                   /db_xref="GeneID:6198057"
FT                   /translation="MQRICWPMRIGHTCRAIFKSIRSAFGWSLMKRGTQLPSRVDSYRA
FT                   LDLYLSAPSAFSSLPLNPVSLLSASFCHERTAWVAV"
FT                   /protein_id="YP_001831056.1"
FT   gene            complement(79777..80442)
FT                   /db_xref="GeneID:6198056"
FT                   /locus_tag="Bind_3767"
FT   CDS_pept        complement(79777..80442)
FT                   /locus_tag="Bind_3767"
FT                   /gene_family="HOG000229705" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2631 hypothetical protein"
FT                   /db_xref="GI:182676910"
FT                   /db_xref="GeneID:6198056"
FT                   /translation="MTMHPFVRAVCDLQFENAFNPYTDRCVVYDRADAAQVRAAALEAM
FT                   IESASTSPVDAIWVGRDLGYRGGRRTGLALTDEVHAGAHLSRWGLEVERPTVGAVVAER
FT                   TAAIIWKMLAQIDARIFLWNVFPLHPHEPGEPFTNRTHNSKERRAGEEILALLIEVLRP
FT                   RRIFAIGNDAAQAVGRIDGRLPVIAVRHPSYGGQAQFLKQIREAYMLQEREPNMPLLL"
FT                   /protein_id="YP_001831057.1"
FT   misc_feature    complement(79861..80139)
FT                   /note="Uracil DNA glycosylase superfamily; Region: UDG;
FT                   cl00483"
FT                   /db_xref="CDD:186027"
FT                   /locus_tag="Bind_3767"
FT   gene            complement(80439..81545)
FT                   /db_xref="GeneID:6198055"
FT                   /locus_tag="Bind_3768"
FT   CDS_pept        complement(80439..81545)
FT                   /locus_tag="Bind_3768"
FT                   /gene_family="HOG000229704" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2630 hypothetical protein"
FT                   /db_xref="GI:182676911"
FT                   /db_xref="GeneID:6198055"
FT                   /translation="MLRDYVAAIDGTDVLGSNDLEPVLLGLYGEVGGIMSAAKKHVREG
FT                   AAFPGFRKAAEEEFGDTLWYFAALCQRLGFSLEDIFTEASRASAYKHVAAASDYSHGAM
FT                   AQIILPKESVQLDSALFELGRAATALLGAAPAKEDLIRFVGHYLEALHGAELNFSTVVR
FT                   ANIRKTRGAFLLPEPSSLPDFDKDFEAEEQLPRRFRIKVSQRASGRTYLQWNDVFIGDP
FT                   LTDNIADRDGYRFHDVFHFAHAAILHWSPVMRALIKQKRKSKRDYDEEQDSGRAIVVEE
FT                   GLTAWIFSRAKELNFFENQSRISFGVLKTIGDFVAGYEVAECPPKLWERAILDGYAIFR
FT                   QMRDAQGGWIVGDREARTISYEPLEEPV"
FT                   /protein_id="YP_001831058.1"
FT   gene            complement(81565..82203)
FT                   /db_xref="GeneID:6198053"
FT                   /locus_tag="Bind_3769"
FT   CDS_pept        complement(81565..82203)
FT                   /locus_tag="Bind_3769"
FT                   /gene_family="HOG000009035" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rfr:Rfer_1064 hypothetical protein"
FT                   /db_xref="GI:182676912"
FT                   /db_xref="GeneID:6198053"
FT                   /translation="MPRLYSYVVRYDSGFAPNPFYGHCSLATCKPDIRKAAQIGDWVVG
FT                   SGSNERRIKRGGYLVYALRVTGALSFQDYDADPRFAKKKPYRHGSRKQSCGDNIYFRND
FT                   ADDEWLQRDSFHTTDAGERHPRHVARDTSVNRVLVSDHFVYFGGYGPPIPKKLVDATGR
FT                   PLCKEGIGRNVFDDPGLIAAFEGWFDALGATGYQDAPYEWRQLRGGGNY"
FT                   /protein_id="YP_001831059.1"
FT   gene            complement(82203..82670)
FT                   /db_xref="GeneID:6198052"
FT                   /locus_tag="Bind_3770"
FT   CDS_pept        complement(82203..82670)
FT                   /locus_tag="Bind_3770"
FT                   /gene_family="HOG000229703" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Domain of unknown function DUF1863; KEGG:
FT                   ajs:Ajs_2628 hypothetical protein"
FT                   /db_xref="GI:182676913"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="GeneID:6198052"
FT                   /translation="MPETKNVFISHVHKDDAGLKKLKDLLEPKGMGIRDSSIHTGKFNN
FT                   ASDENYIKTQILAPAINWAGVFICYVSPETKDSDWVNWEIEYAAKQGKRIVGVWEHGQK
FT                   ECELPSALEEYADAVVGWNGDAIIDAINGKDGWEKPDGGPCDTVPLKKHPC"
FT                   /protein_id="YP_001831060.1"
FT   misc_feature    complement(82317..82658)
FT                   /note="MTH538 TIR-like domain (DUF1863); Region: DUF1863;
FT                   pfam08937"
FT                   /db_xref="CDD:149871"
FT                   /locus_tag="Bind_3770"
FT   gene            82979..84136
FT                   /db_xref="GeneID:6198051"
FT                   /locus_tag="Bind_3771"
FT   CDS_pept        82979..84136
FT                   /locus_tag="Bind_3771"
FT                   /gene_family="HOG000229707" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sdn:Sden_3578 hypothetical protein"
FT                   /db_xref="GI:182676914"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="GeneID:6198051"
FT                   /translation="MANYELLVLGSPPPGTGDILTTRLMEVADQFGMTIPDDLAVRSAA
FT                   DAGNRNATASIAALYFGGDPAVDAGLVDELEAACVPIVPVVPEGGKVSTTIPAELQAIN
FT                   AFFIAPSDAGLYALAALALECLGLLRRQRRVFVSYRRDDSRTLAVQLHDELSGRGFDVF
FT                   LDTHDILPGDVFQELLWHRLADCDVVIMLDTKDYFGSKWTKQELGRSLAQGIQILRVIW
FT                   PGHTPTRHLSLSDAMQLTDADFDPGGQLVARRIDEVVRRTESLRSRSVASRHREIAGSL
FT                   RVQVERIGGKFEGIGAHRAMALTLPNGLAIQAYPVVGVPTAELLNDVHDKALAAKHGRF
FT                   PCLAYDHHGIRPAWRSHLEWLDKQVKEVRALRVFDAAWELAEWDS"
FT                   /protein_id="YP_001831061.1"
FT   misc_feature    83402..>83641
FT                   /note="TIR domain; Region: TIR; cl02060"
FT                   /db_xref="CDD:186511"
FT                   /locus_tag="Bind_3771"
FT   gene            84124..84792
FT                   /db_xref="GeneID:6198050"
FT                   /locus_tag="Bind_3772"
FT   CDS_pept        84124..84792
FT                   /locus_tag="Bind_3772"
FT                   /gene_family="HOG000254621" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pca:Pcar_2915 hypothetical protein"
FT                   /db_xref="GI:182676915"
FT                   /db_xref="GeneID:6198050"
FT                   /translation="MGQLKAKAAVFLSAGVPDPAAPHFLGEGDSVAISAAVAALLEVTL
FT                   GRRKLVWGGHPAITPMVWAFAESMGVDYGEWVLLYQSRRFEDEFPEETALFSNVVFTER
FT                   VGTDISANLAFMRSLMIEENQFEAAVFIGGMQGIVDEYRLFSVRAPNAIILPVASTGGA
FT                   ARVLNEMLGGDPALAGNLDYVQLLYERLGIDPNEQRYAKPADQPAEVAARIEIPGRSRR
FT                   "
FT                   /protein_id="YP_001831062.1"
FT   gene            complement(84891..86063)
FT                   /db_xref="GeneID:6198049"
FT                   /locus_tag="Bind_3773"
FT   CDS_pept        complement(84891..86063)
FT                   /locus_tag="Bind_3773"
FT                   /gene_family="HOG000002860" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; KEGG: sme:SMa2257
FT                   possible integrase-like protein"
FT                   /db_xref="GI:182676916"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:6198049"
FT                   /translation="MRKSALPLPEKPLEAGTVPRLDALASILPGERREGLATQLTDEDV
FT                   ATLKHLVEIGMGANTLRALASDCAYLEAWAQAATGSPLPWPVPEALVLKFLAHHLWDPI
FT                   RREIDPEHGMPEGVSAALRASGQLRVEGPHAPATVERRLASWRTLHRWRGLEGPFTSPT
FT                   LRSAWRLAVRANPRPRQRKSAKAVTKDVLTELLKTCHGGRLVDLRDRALLLVAFASGGR
FT                   RRSEVAGLRVEQLHEEAPVPADPLDPMSPRLPCLSIQLGRTKTSDADEDARVLLVGSPV
FT                   EALRAWMKVAAITKGALFRPIDCWDNVAPCALTPQAVNQILKQRCAKAGLDPRLFSAHG
FT                   LRSGYLTEAGRAGVSLPEAMQQSQHRSIQQAARYYNDAERRLGKAARILE"
FT                   /protein_id="YP_001831063.1"
FT   misc_feature    complement(84897..85889)
FT                   /note="Cre recombinase, C-terminal catalytic domain.
FT                   Cre-like recombinases belong to the superfamily of DNA
FT                   breaking-rejoining enzymes, which share the same fold in
FT                   their catalytic domain and the overall reaction mechanism.
FT                   The bacteriophage P1 Cre...; Region: INT_Cre; cd00799"
FT                   /db_xref="CDD:29500"
FT                   /locus_tag="Bind_3773"
FT   misc_feature    complement(order(84942..84944,85047..85055,85107..85109,
FT                   85113..85115,85155..85163,85389..85397,85437..85439,
FT                   85641..85643,85650..85655,85857..85859,85878..85880,
FT                   85884..85889))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29500"
FT                   /locus_tag="Bind_3773"
FT   misc_feature    complement(order(84897..84902,84906..84914,85017..85019,
FT                   85029..85031,85407..85412,85497..85499,85554..85559,
FT                   85563..85565,85569..85571,85782..85787,85794..85796))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29500"
FT                   /locus_tag="Bind_3773"
FT   misc_feature    complement(84921..85511)
FT                   /note="Phage integrase family; Region: Phage_integrase;
FT                   pfam00589"
FT                   /db_xref="CDD:144254"
FT                   /locus_tag="Bind_3773"
FT   misc_feature    complement(order(84942..84944,84969..84971,85038..85040,
FT                   85047..85049,85272..85274,85395..85397))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29500"
FT                   /locus_tag="Bind_3773"
FT   misc_feature    complement(order(84942..84944,85038..85040,85047..85049,
FT                   85272..85274,85395..85397))
FT                   /note="active site"
FT                   /db_xref="CDD:29500"
FT                   /locus_tag="Bind_3773"
FT   gene            complement(86060..86476)
FT                   /db_xref="GeneID:6198047"
FT                   /locus_tag="Bind_3774"
FT   CDS_pept        complement(86060..86476)
FT                   /locus_tag="Bind_3774"
FT                   /gene_family="HOG000012975" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PilT domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   smd:Smed_6500 PilT protein domain protein"
FT                   /db_xref="GI:182676917"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="GeneID:6198047"
FT                   /translation="MVFVVDASIAAAWFLPDEQSEASDQVMAALGKEAGCVPGLFWFET
FT                   RNLFLTAERRGRLRAGEALLSMQQLRALPLREEPVDQDAFVLSLAQRRSLSGYDASYLA
FT                   LALAQTLPLATTDQKLAAAARAEEVPVLGPLASS"
FT                   /protein_id="YP_001831064.1"
FT   gene            complement(86476..86718)
FT                   /db_xref="GeneID:6198046"
FT                   /locus_tag="Bind_3775"
FT   CDS_pept        complement(86476..86718)
FT                   /locus_tag="Bind_3775"
FT                   /gene_family="HOG000211899" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prevent-host-death family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   rpa:RPA1834 hypothetical protein"
FT                   /db_xref="GI:182676918"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="GeneID:6198046"
FT                   /translation="MTITVKIGEAKTHLSDLLAKVEAGEEVIIARGPEPIARLTRFRPE
FT                   KSVETVIAEIKAARAHRAKTTPEEIHAWRDEGRRF"
FT                   /protein_id="YP_001831065.1"
FT   misc_feature    complement(86482..86718)
FT                   /note="Phd_YefM; Region: PhdYeFM; cl09153"
FT                   /db_xref="CDD:186840"
FT                   /locus_tag="Bind_3775"
FT   gene            87016..87324
FT                   /db_xref="GeneID:6198045"
FT                   /locus_tag="Bind_3776"
FT   CDS_pept        87016..87324
FT                   /locus_tag="Bind_3776"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676919"
FT                   /db_xref="GeneID:6198045"
FT                   /translation="MANPRATHPFVLRADKTMKREASAGALGRRHAFPLNQAIEFSSNA
FT                   NTWPSAASRQAWRLAETAALFRLRRSSPAFGRGEDPSPSPLPAIESLNRLPHRRKDT"
FT                   /protein_id="YP_001831066.1"
FT   gene            87321..88394
FT                   /db_xref="GeneID:6198044"
FT                   /locus_tag="Bind_3777"
FT   CDS_pept        87321..88394
FT                   /locus_tag="Bind_3777"
FT                   /gene_family="HOG000274259" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1612; KEGG:
FT                   nha:Nham_4505 protein of unknown function DUF1612"
FT                   /db_xref="GI:182676920"
FT                   /db_xref="InterPro:IPR011670"
FT                   /db_xref="GeneID:6198044"
FT                   /translation="MMDWQTLPWPQLIGPLIAAEDALARLDSRLAASPIRDGWIARMDV
FT                   LEACASISLDGGLVDLADLVLRDANMDSAPSSEVLTRAEQVLAARRRIAKARPRWALSP
FT                   EGLASLTGRSGDPERVSQTESRDGEGDREAGQGDETEEVWASPFAALDAAMARVTQRLA
FT                   QVEAGLKPVLSATAADRVLAPWLAVQKTTEACPPTLAAAIAYEAWVDLRPLPQQDWLGR
FT                   LLAASSLRCRGKTETHLVCFNVGLRALPPLLIRPKITADRLARTLDAFTAAARKGLVDH
FT                   DRWLTARELFLRKTEGRRSTSHLAALVDLVLRRPVVSSDLIAKELKITPRAAQTLVATL
FT                   GLRELTGRGRYRAWGIV"
FT                   /protein_id="YP_001831067.1"
FT   misc_feature    87864..88211
FT                   /note="Protein of unknown function (DUF1612); Region:
FT                   DUF1612; pfam07756"
FT                   /db_xref="CDD:149040"
FT                   /locus_tag="Bind_3777"
FT   misc_feature    88230..88391
FT                   /note="HTH DNA binding domain; Region: HTH_13; pfam11972"
FT                   /db_xref="CDD:152407"
FT                   /locus_tag="Bind_3777"
FT   gene            complement(88840..89535)
FT                   /db_xref="GeneID:6198043"
FT                   /locus_tag="Bind_3778"
FT   CDS_pept        complement(88840..89535)
FT                   /locus_tag="Bind_3778"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gbe:GbCGDNIH1_1414 hypothetical secreted
FT                   protein"
FT                   /db_xref="GI:182676921"
FT                   /db_xref="GeneID:6198043"
FT                   /translation="MTTKTFARSIYHGTRYSVLILAGFGAACLGAENVRAYSLPTKVKF
FT                   QHQVIYVIDFELQPNSIKSESLFSNLQVHTFMEQAKAKSLPSLMSNAIVNDLTNKGMEA
FT                   YRLPAGTPLPKNGLLVSGTFLQINEGNRLQRAIIGFGAGHTHLQVEINLSDLSRNKVST
FT                   EVYKMQIDASSGKLPGAIITPHPYAAAAKYFFAGHDLDRNIMHGASKIAEDILAHMDVK
FT                   LANRKAEIQ"
FT                   /protein_id="YP_001831068.1"
FT   sig_peptide     complement(89425..89535)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.872 at
FT                   residue 37"
FT                   /locus_tag="Bind_3778"
FT   gene            complement(89803..90072)
FT                   /db_xref="GeneID:6198042"
FT                   /locus_tag="Bind_3779"
FT   CDS_pept        complement(89803..90072)
FT                   /locus_tag="Bind_3779"
FT                   /gene_family="HOG000271774" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rle:RL3601 hypothetical protein"
FT                   /db_xref="GI:182676922"
FT                   /db_xref="GeneID:6198042"
FT                   /translation="MITLNHRPFITAAALLAVFAARPNAALAQMPAQAQALQQICRGDY
FT                   TRLCSGVQPGGGRILTCLQSHLGELTSACQKALTKAPGANALPK"
FT                   /protein_id="YP_001831069.1"
FT   sig_peptide     complement(89986..90072)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.720 at
FT                   residue 29"
FT                   /locus_tag="Bind_3779"
FT   misc_feature    complement(89860..>89952)
FT                   /note="Cysteine rich repeat; Region: Cys_rich_FGFR;
FT                   pfam00839"
FT                   /db_xref="CDD:144435"
FT                   /locus_tag="Bind_3779"
FT   gene            complement(90078..91010)
FT                   /db_xref="GeneID:6198041"
FT                   /locus_tag="Bind_3780"
FT   CDS_pept        complement(90078..91010)
FT                   /locus_tag="Bind_3780"
FT                   /gene_family="HOG000263963" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="fatty acid hydroxylase"
FT                   /transl_table="11"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: rle:RL3600
FT                   putative transmembrane fatty acid synthesis protein"
FT                   /db_xref="GI:182676923"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="GeneID:6198041"
FT                   /translation="MLTYLTLTNYPAMRLLVPVTALSFMVLEYLVSRLAHREKATHDLA
FT                   ESASSLCIAVGNNLIRPLEAGLISMPFIFVYDHRLIDFASTTSISIGILFLATEFQYYW
FT                   QHRCAHRIRWMWATHAVHHSPTKINLTAAIRLGWTSNLSGNFLFFLPLAWIGFHPVAIA
FT                   AMLGSNLLYQFFIHTELAPRLGPLEWVLNTPAHHRVHHASNSSCLDKNYGGVLILFDRL
FT                   FGTFAEAPTDEALRYGLHGSARTLNPFHTAFDEWVTLAHDLKHAPSFIAKLRVLFSPPG
FT                   SAPSWRSSTHDRGAEVTTSPTSSCIIAGE"
FT                   /protein_id="YP_001831070.1"
FT   misc_feature    complement(90225..>90836)
FT                   /note="Fatty acid hydroxylase superfamily; Region:
FT                   FA_hydroxylase; cl01132"
FT                   /db_xref="CDD:186350"
FT                   /locus_tag="Bind_3780"
FT   gene            91189..91905
FT                   /db_xref="GeneID:6198040"
FT                   /locus_tag="Bind_3781"
FT   CDS_pept        91189..91905
FT                   /locus_tag="Bind_3781"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bbt:BBta_3219 two-component
FT                   response transcriptional regulator (OmpR family)"
FT                   /db_xref="GI:182676924"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="GeneID:6198040"
FT                   /translation="MTTLLIVEDDPDIRQLIGELMRNEGFHIEEAENAAAMDATMTRIR
FT                   PDLLILDLMLPGEDGLSICRRIRTHSIMPILMLTAKSDEIDRVVGLEMGADDYLVKPFG
FT                   PRELLARVRALLRRAAALSPVMSSRRFAFDRFIIDLDARQVTDDKGLALTFTSAEFDLL
FT                   ACFVQRPRRVLTRDQILNQIRGRITDPFDRTVDMLISRIRRKLDAACPGSNLISTIRNG
FT                   GYLFTAPVKPAPQCSG"
FT                   /protein_id="YP_001831071.1"
FT   misc_feature    91198..91875
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]; Region:
FT                   OmpR; COG0745"
FT                   /db_xref="CDD:31088"
FT                   /locus_tag="Bind_3781"
FT   misc_feature    91201..91503
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bind_3781"
FT   misc_feature    order(91210..91215,91342..91344,91366..91368,91423..91425,
FT                   91480..91482,91489..91494)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bind_3781"
FT   misc_feature    91342..91344
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bind_3781"
FT   misc_feature    order(91351..91356,91360..91368)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bind_3781"
FT   misc_feature    91489..91497
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bind_3781"
FT   misc_feature    91579..91866
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Bind_3781"
FT   misc_feature    order(91654..91656,91711..91716,91768..91770,91777..91779,
FT                   91801..91806,91840..91842,91855..91857)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Bind_3781"
FT   gene            91893..93278
FT                   /db_xref="GeneID:6198039"
FT                   /locus_tag="Bind_3782"
FT   CDS_pept        91893..93278
FT                   /locus_tag="Bind_3782"
FT                   /gene_family="HOG000218775" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   bbt:BBta_3220 putative two-component sensor histidine
FT                   kinase"
FT                   /db_xref="GI:182676925"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:6198039"
FT                   /translation="MLRLSLAARLSMIVIIVLMAVWLAALASFYRSRLSSDQYTQPKAQ
FT                   QIAAIVNLVEGVHPEQRPLILDAVTSSILEIKLETGQTQMRQKPASLPNQQLFDNALLQ
FT                   NYIDALGEHPFTITSVRKTTEKWRLLRFSWMIPNALEFRITLKTGDLLIIDAQSPLAMT
FT                   RLGWPVGFGAGLLGTLVALVALILMYRETRPLSRLAAAVDRMDLIDTPVVLPKARTSAL
FT                   EVQALIAAFNRLQNRLAQLLRARMAMLGGISHDVRTFATRLRLRVEQIPEGTERDRAIG
FT                   DIADMIRLLDDALLASRAGAGEFSEELVELDQIVRSEVEDRKAAGASIDLSISRGAVGI
FT                   PVLGDRLALRRIVSNLADNALQYGHSAYLTVEIEAQTLVLSVDDEGAGIPSELSEILLE
FT                   PFVRLETSRNRRTGGAGLGLAIVRTLIEAHSGTISIGAAPTGGARFIVRLPIFTVSSIK
FT                   SKY"
FT                   /protein_id="YP_001831072.1"
FT   sig_peptide     91893..91976
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.617 at
FT                   residue 28"
FT                   /locus_tag="Bind_3782"
FT   misc_feature    <92460..93245
FT                   /note="osmolarity sensor protein; Provisional; Region:
FT                   envZ; PRK09467"
FT                   /db_xref="CDD:181882"
FT                   /locus_tag="Bind_3782"
FT   misc_feature    92937..93239
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bind_3782"
FT   misc_feature    order(92955..92957,92967..92969,92976..92978,93036..93038,
FT                   93042..93044,93048..93050,93054..93059,93138..93149,
FT                   93195..93197,93201..93203,93216..93221,93225..93227)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bind_3782"
FT   misc_feature    92967..92969
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bind_3782"
FT   misc_feature    order(93048..93050,93054..93056,93138..93140,93144..93146)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bind_3782"
FT   gene            93737..93961
FT                   /db_xref="GeneID:6198038"
FT                   /locus_tag="Bind_3783"
FT   CDS_pept        93737..93961
FT                   /locus_tag="Bind_3783"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676926"
FT                   /db_xref="GeneID:6198038"
FT                   /translation="MPEIYAYLDIENLAEALGPDGAIVVDALEDLGKQVHDCLSMQFSD
FT                   NFELFPWFSNIEASTHRQERQQKIQDQNV"
FT                   /protein_id="YP_001831073.1"
FT   gene            complement(94775..95515)
FT                   /db_xref="GeneID:6198037"
FT                   /locus_tag="Bind_3784"
FT   CDS_pept        complement(94775..95515)
FT                   /locus_tag="Bind_3784"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rpc:RPC_3230 hypothetical protein"
FT                   /db_xref="GI:182676927"
FT                   /db_xref="GeneID:6198037"
FT                   /translation="MQKVMDRHSDIANSFGMPGADWWNPRRLCLLPQVTAISLIMTLLG
FT                   GCAGAQITNIASTKVTGPQPAQILVDVDVVPVPNTSEMKLAEEVATKLKADLIKRLQEA
FT                   KLTTEPFVPGIRHPGAAILHVAIMKADKGNPVTRLVIGFGVGRAELQAKADFVNDDSAP
FT                   VHSMTAFKTSSDSGFMPGLIVPGGAALATAHVVTLAVGGGIRVVTGLRDGLNKPIRGTS
FT                   IAIVEQLKKYYASVGWRWPAGDIV"
FT                   /protein_id="YP_001831074.1"
FT   gene            complement(95800..96129)
FT                   /db_xref="GeneID:6198036"
FT                   /locus_tag="Bind_3785"
FT   CDS_pept        complement(95800..96129)
FT                   /locus_tag="Bind_3785"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gbe:GbCGDNIH1_1860 hypothetical secreted
FT                   protein"
FT                   /db_xref="GI:182676928"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="GeneID:6198036"
FT                   /translation="MVRKLILASLLATGAACLIDSPAKAGGWAAWGHGGAVWGHPGVYQ
FT                   GYHGCCYGGGAVAAGAITGLAAGAAIGAAASKPAYPPPVVYAPPRVVYVTPPVVYTTPR
FT                   VIYVR"
FT                   /protein_id="YP_001831075.1"
FT   sig_peptide     complement(96052..96129)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.939 at
FT                   residue 26"
FT                   /locus_tag="Bind_3785"
FT   gene            complement(96694..97451)
FT                   /db_xref="GeneID:6198035"
FT                   /locus_tag="Bind_3786"
FT                   /pseudo
FT   gene            98201..98908
FT                   /db_xref="GeneID:6198034"
FT                   /locus_tag="Bind_3787"
FT                   /pseudo
FT   gene            98911..99576
FT                   /db_xref="GeneID:6198033"
FT                   /locus_tag="Bind_3788"
FT   CDS_pept        98911..99576
FT                   /locus_tag="Bind_3788"
FT                   /gene_family="HOG000242838" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromosome segregation and condensation protein
FT                   ScpB"
FT                   /transl_table="11"
FT                   /note="PFAM: chromosome segregation and condensation
FT                   protein ScpB; KEGG: nha:Nham_4583 putative transcriptional
FT                   regulator"
FT                   /db_xref="GI:182676929"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="GeneID:6198033"
FT                   /translation="MAKRSRSDTALDRELEDLPPPLRWREWMRRVEALLFAASEPVSRE
FT                   VLARVVGVSCAIEALIGDLRADLRGRPYDVVAVNGGWQLRTRPALAPVLRAAGFLKKGE
FT                   GDFSPKEALLLLAIGHFQPITPARLGEFFGREISRDTLAWLCAQKWTGSGPRSPEPGAP
FT                   ITYVTTREFLEQFGFASLADLPGQGLFAGAWTDGEEAFGPLLPQPDDNNQNEEKLYPQ"
FT                   /protein_id="YP_001831076.1"
FT   misc_feature    98989..99507
FT                   /note="Putative transcriptional regulators (Ypuh-like);
FT                   Region: DUF387; cl00612"
FT                   /db_xref="CDD:186106"
FT                   /locus_tag="Bind_3788"
FT   gene            99690..100520
FT                   /db_xref="GeneID:6198032"
FT                   /locus_tag="Bind_3789"
FT   CDS_pept        99690..100520
FT                   /locus_tag="Bind_3789"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676930"
FT                   /db_xref="GeneID:6198032"
FT                   /translation="MVTPEAMNLFHDIITHEMFEMNRILEEVQQVTLSNLASRGLTQSG
FT                   PAMQLVIQNATNSLKTRAQFILGQLLRCLASFHVPLDKETITEALSLLRDTIEMQADDI
FT                   GRRVYQYPVFSIRGLEQAKHQLQAQYAQEGPRLIDRLSAELKLAAAASQNSRPQGAPSF
FT                   TFHGPIGLVQTGDGSQATVRQHINTDVKNQITTALQLFLDQLDMPDSNSIGNRTELREL
FT                   IAEAKAEVEKPECNTLKLGSSLRTIAETTKFVGSLAPAYSVLKPLISYLGIHLP"
FT                   /protein_id="YP_001831077.1"
FT   gene            100633..100851
FT                   /db_xref="GeneID:6198031"
FT                   /locus_tag="Bind_3790"
FT   CDS_pept        100633..100851
FT                   /locus_tag="Bind_3790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676931"
FT                   /db_xref="GeneID:6198031"
FT                   /translation="MWSALASFLLGVLGWVVPKLLIEPGKEIFDLRRETQESLIIYGDL
FT                   PKDAPADERRLAAEIFETGKKRGVRLL"
FT                   /protein_id="YP_001831078.1"
FT   gene            complement(100907..102273)
FT                   /db_xref="GeneID:6198030"
FT                   /locus_tag="Bind_3791"
FT                   /pseudo
FT   gene            complement(102390..102587)
FT                   /db_xref="GeneID:6198029"
FT                   /locus_tag="Bind_3792"
FT   CDS_pept        complement(102390..102587)
FT                   /locus_tag="Bind_3792"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676932"
FT                   /db_xref="GeneID:6198029"
FT                   /translation="MQGRIKLEATTGWGEVIEYEVGQLERQFATATAEDFGPTLKESKD
FT                   ILRQFQSAWTEKNVWLSDCR"
FT                   /protein_id="YP_001831079.1"
FT   gene            102746..104059
FT                   /db_xref="GeneID:6198028"
FT                   /locus_tag="Bind_3793"
FT   CDS_pept        102746..104059
FT                   /locus_tag="Bind_3793"
FT                   /gene_family="HOG000263907" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rle:RL4218 putative mannitol-binding component of ABC
FT                   transporter"
FT                   /db_xref="GI:182676933"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:6198028"
FT                   /translation="MRLRGILLGACAALTLAGPAGAETLTIATVNNGDIIRMQKLTDDF
FT                   KAKNPDIDLKWVTLEENVLRQKVTTDIATKGGQFDIMTIGNYEVPIWAKRGWLLPLDNL
FT                   GANYDEADLLPSIREAVSSGGKLYASPFYGESAMVMYRTDLFAKVGLTMPADPTWDFIA
FT                   EAARKITDKNASVYGICLRGKAGWGENMAFLTALANSMGGRWFDEQWKPQFDQPEWKNA
FT                   VDYYVKLMKDAGPPGASSNGFNENLALFQTGKCGIWIDATVAASFVSNPKDSTVADKVG
FT                   YALFPTSGTFDNHGNWLWAWSLAVPAGTKKDKAAQKFITWATDKAYIELVASKDGWANV
FT                   PPGTRASLYDNPHYQQAAPFASLTLAAIKAANTAKPAVKPVPYIGGQFVAIPEFQGIGT
FT                   AVGQQFSAALAGQVTTDQALRSAQQLVTREMTKAGYIK"
FT                   /protein_id="YP_001831080.1"
FT   sig_peptide     102746..102814
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT                   /locus_tag="Bind_3793"
FT   misc_feature    102827..104041
FT                   /note="ABC-type sugar transport system, periplasmic
FT                   component [Carbohydrate transport and metabolism]; Region:
FT                   UgpB; COG1653"
FT                   /db_xref="CDD:31839"
FT                   /locus_tag="Bind_3793"
FT   misc_feature    102857..103726
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Bind_3793"
FT   gene            104157..105062
FT                   /db_xref="GeneID:6198027"
FT                   /locus_tag="Bind_3794"
FT   CDS_pept        104157..105062
FT                   /locus_tag="Bind_3794"
FT                   /gene_family="HOG000220410" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:RL4217 putative
FT                   mannitol transmembrane permease component of ABC
FT                   transporter"
FT                   /db_xref="GI:182676934"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:6198027"
FT                   /translation="MPIRSIYPRFAMATLHTRSAARLMMAPSVLLLLAWMIIPLAMTIY
FT                   FSFLRYNLLMPGTEEFAGLANYQYFLTDPAFFTALANTLLIVGGVLLITVIGGIALALL
FT                   LDQPMYGQGIVRILVIAPFFVMPTVSALVWKNMFMNPVNGLFAWIAGSFGLQPIDWLAS
FT                   VPLLSIIIIIAWQWLPFSTLILLTALQSLNEEQKEAAEMDGAGAISTFIYIVLPHMARA
FT                   ITVVVLIQTIFLLSVFAEILVTTNGGPGVQSTNLTFLVYTQALLQFDIGGASAGGIVAV
FT                   VLANIVAVFLIRLIGKNLEA"
FT                   /protein_id="YP_001831081.1"
FT   sig_peptide     104157..104282
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.640 at
FT                   residue 42"
FT                   /locus_tag="Bind_3794"
FT   misc_feature    104184..104966
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:185990"
FT                   /locus_tag="Bind_3794"
FT   gene            105065..105895
FT                   /db_xref="GeneID:6198026"
FT                   /locus_tag="Bind_3795"
FT   CDS_pept        105065..105895
FT                   /locus_tag="Bind_3795"
FT                   /gene_family="HOG000220526" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:RL4216 putative
FT                   mannitol transmembrane permease component of ABC
FT                   transporter"
FT                   /db_xref="GI:182676935"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:6198026"
FT                   /translation="MARRYSARRELAMTIIAWTVGLAIFFPILWTVLTSFKTEAEAVAS
FT                   PPSFLFFHWTTENYAEVQSRSNYLAHFMNSAVISLGSTLAALVIAIPAAWAMAFSPTKR
FT                   TKDVLMWMLSTKMMPPVGALIPVYLIFRDTGLLDTRPGLVIVLTLINLPIVTWMLYTYF
FT                   KEIPGEILEAARMDGASLLKEIVYVLTPMAVPGIASTLLLNVILAWNEAFWTLNLTTSE
FT                   AAPLTAFIASYSSPEGLFYGKLSAASTMAIAPILILGWFSQKQLVRGLTFGAVK"
FT                   /protein_id="YP_001831082.1"
FT   misc_feature    <105413..105832
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bind_3795"
FT   misc_feature    order(105413..105430,105437..105442,105446..105448,
FT                   105509..105514,105518..105520,105524..105526,
FT                   105533..105538,105542..105544,105554..105559,
FT                   105566..105568,105617..105619,105659..105664,
FT                   105671..105673,105692..105703,105710..105715,
FT                   105749..105754,105782..105787,105794..105799,
FT                   105803..105808,105815..105820,105827..105832)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bind_3795"
FT   misc_feature    order(105413..105448,105692..105709)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bind_3795"
FT   misc_feature    order(105446..105448,105494..105496,105710..105712,
FT                   105743..105745,105752..105754,105782..105784)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bind_3795"
FT   misc_feature    order(105569..105607,105623..105628,105638..105640)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bind_3795"
FT   gene            105906..106904
FT                   /db_xref="GeneID:6198025"
FT                   /locus_tag="Bind_3796"
FT   CDS_pept        105906..106904
FT                   /locus_tag="Bind_3796"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: atc:AGR_L_3278 ATP-binding transport protein SmoK
FT                   (POLK)"
FT                   /db_xref="GI:182676936"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="GeneID:6198025"
FT                   /translation="MGSISLQKVAKHFGPLKVIPSIDLEINDGEFVVFVGPSGCGKSTL
FT                   LRLIAGLEDVSSGKIVIDGKDATYAPPSQRGLAMVFQSYALYPHMSVRSNIAFPLKMAG
FT                   MAKEEIDRKVNDAARVLNLTDYLDRKPRQLSGGQRQRVAIGRAIVRQPSAFLFDEPLSN
FT                   LDAALRVNMRLEISELHQTLKTTMIYVTHDQVEAMTMADKIVVLNRGHIEQVGSPLELY
FT                   RKPANLFVASFIGSPKMNLIGGAYARSKHAATVGIRPEHIKLSRQGGVWSGTVSVVEHL
FT                   GSDTFFHIDVDGIGPVTARTDGDFDAHHDDRLFLIPDETKLYRFNEEGVAL"
FT                   /protein_id="YP_001831083.1"
FT   misc_feature    105906..106892
FT                   /note="glycerol-3-phosphate transporter ATP-binding
FT                   subunit; Provisional; Region: ugpC; PRK11650"
FT                   /db_xref="CDD:183258"
FT                   /locus_tag="Bind_3796"
FT   misc_feature    105915..106553
FT                   /note="The N-terminal ATPase domain of the maltose
FT                   transporter, MalK.  ATP binding cassette (ABC) proteins
FT                   function from bacteria to human, mediating the
FT                   translocation of substances into and out of cells or
FT                   organelles.  ABC transporters contain two...; Region:
FT                   ABC_MalK_N; cd03301"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Bind_3796"
FT   misc_feature    106011..106034
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Bind_3796"
FT   misc_feature    order(106020..106025,106029..106037,106149..106151,
FT                   106377..106382,106479..106481)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Bind_3796"
FT   misc_feature    106140..106151
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Bind_3796"
FT   misc_feature    106305..106334
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Bind_3796"
FT   misc_feature    106365..106382
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Bind_3796"
FT   misc_feature    106389..106400
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Bind_3796"
FT   misc_feature    106467..106487
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Bind_3796"
FT   misc_feature    106668..>106832
FT                   /note="TOBE domain; Region: TOBE_2; cl01440"
FT                   /db_xref="CDD:163979"
FT                   /locus_tag="Bind_3796"
FT   gene            106999..108978
FT                   /db_xref="GeneID:6198024"
FT                   /locus_tag="Bind_3797"
FT   CDS_pept        106999..108978
FT                   /locus_tag="Bind_3797"
FT                   /gene_family="HOG000202982" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mannitol dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: atc:AGR_L_830 mannitol
FT                   2-dehydrogenase (MDH)"
FT                   /db_xref="GI:182676937"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="GeneID:6198024"
FT                   /translation="MTGKLSLAALNEIAAPTAVPTYARESLSAGIVHFGVGNFHRAHQA
FT                   VYLDELFNAGQDLDWAIIGAGVMPSDALIREKLLAQDCLTTIVEQDNNRTAARVTGAMI
FT                   DILPTGDAAAIIERLAEPAIRIVSMTITEGGYYLDANGAFNPKHPAIVEDGRHPEAPRT
FT                   VFGLIVAGLKARREKGIEPFTVLSCDNIPHNGKVTYNAVTGLARLADPDFANWIAANVS
FT                   FPNSMVDRITPATGQREIDIAREDFGIEDNWPVFCEEFRQWVIEDKFPAGRPALEKVGV
FT                   QFVLDVSPYELMKIRILNGGHAAIAYPAALLDIHFVHEAMEEPLIRSFLAKLEREEIIP
FT                   VVPPVPDTDIDAYFQLIERRFSNSKIGDTIPRLAQDGSNRQPKFILPTTKDRLARGDDV
FT                   IGLSLVSALWCRYFAGTSDSGKDIVFNDASAERLHAAALEAKTDPSAFLALEDIFGTIG
FT                   HSELFARRFSHALKTLWEKGTRETLTLYLGLRPNQPYFDSMAWSRVEAKSMDTNLFWFS
FT                   DKQWAKIVPHLPTNQPGPQRGDDRRILSGIMHVLTAGCRWKDCPKEYGPFKTVYNRFVR
FT                   WSERGIWQKIFAHAAAPEAAPEQAALDSTHVKLHRCAAGGQGGLKRRRSASRRAAVTAK
FT                   STRSSTSSAVPGRSSSRQVIPPTV"
FT                   /protein_id="YP_001831084.1"
FT   misc_feature    107038..108456
FT                   /note="Mannitol-1-phosphate/altronate dehydrogenases
FT                   [Carbohydrate transport and metabolism]; Region: MtlD;
FT                   COG0246"
FT                   /db_xref="CDD:30595"
FT                   /locus_tag="Bind_3797"
FT   misc_feature    107086..107571
FT                   /note="Mannitol dehydrogenase Rossmann domain; Region:
FT                   Mannitol_dh; pfam01232"
FT                   /db_xref="CDD:144722"
FT                   /locus_tag="Bind_3797"
FT   misc_feature    107653..108366
FT                   /note="Mannitol dehydrogenase C-terminal domain; Region:
FT                   Mannitol_dh_C; pfam08125"
FT                   /db_xref="CDD:149275"
FT                   /locus_tag="Bind_3797"
FT   misc_feature    108535..>108759
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3293"
FT                   /db_xref="CDD:33102"
FT                   /locus_tag="Bind_3797"
FT   gene            108978..109280
FT                   /db_xref="GeneID:6198023"
FT                   /locus_tag="Bind_3798"
FT                   /pseudo
FT   gene            109326..109610
FT                   /db_xref="GeneID:6198022"
FT                   /locus_tag="Bind_3799"
FT                   /pseudo
FT   gene            109838..110467
FT                   /db_xref="GeneID:6198021"
FT                   /locus_tag="Bind_3800"
FT   CDS_pept        109838..110467
FT                   /locus_tag="Bind_3800"
FT                   /gene_family="HOG000057768" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sorbitol dehydrogenase small subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2097 sorbitol dehydrogenase small
FT                   subunit"
FT                   /db_xref="GI:182676938"
FT                   /db_xref="GeneID:6198021"
FT                   /translation="MKSVFERQNRYCPHPLLQSGPPNALKTGPSVQLRRRDVLLASVGS
FT                   LVAYGIAGAAPSIETATSPDVARFMDISHSLTDRSKLDPRIGAALYAGIVNSAPERKAQ
FT                   LTKLHALMNTGRLTTSADLAKTAEKVDPALKDVIHDIMTGWYRGVADGKVVVYRSALMF
FT                   DITKDAIYPKTYAAGGPFYWTTQPPEVAQPSGQPVLSPSSFVVEPT"
FT                   /protein_id="YP_001831085.1"
FT   misc_feature    109937..110413
FT                   /note="Membrane bound FAD containing D-sorbitol
FT                   dehydrogenase; Region: FAD-SLDH; pfam12318"
FT                   /db_xref="CDD:152753"
FT                   /locus_tag="Bind_3800"
FT   gene            110490..112127
FT                   /db_xref="GeneID:6198019"
FT                   /locus_tag="Bind_3801"
FT   CDS_pept        110490..112127
FT                   /locus_tag="Bind_3801"
FT                   /gene_family="HOG000178853" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; FAD
FT                   dependent oxidoreductase; KEGG: zmo:ZMO1285 solbitol
FT                   dehydrogenase large subunit"
FT                   /db_xref="GI:182676939"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="GeneID:6198019"
FT                   /translation="MSSDQNVSADVVIVGSGVAGSSIANELARAGISVIVLEAGPRVDR
FT                   QHFVENFRNLENKPSYQGPFPSTPWAPHPPNQMTPNQYLHTTGPNAEAYQQVYLRMIGG
FT                   TTWHWAGCAWRFLPSDFELKTRYGQGRDWALKYDDLEPFYYQAEVMMGVCGPDPKIEDL
FT                   GSPRKQPYPMSALPISYAAQQFRKLISKQTPWRIVHEPQARNTQPYDGRPTCEGHNNCM
FT                   PICPIGAMYNGSYSVYHAEAAGATFIPNAVAYRIERDAANRKVTAVHYYDPDKGSHRVA
FT                   GKYFVIAAHCIETAKLLLVSADDKSPDGVANSSSHVGRNMMDHTGVQVTFISGDKALWP
FT                   GRGPLLTNVIDTFRDGDWRGEHGAYLVHMVDDNQVDLATQLAISKGYVGHDLEEQIRYL
FT                   ASHTVRLFSHNEALPDPDNRLTLSKTHKDALGIPHPEVYYKLPDYTVRSCEHTRGVFRQ
FT                   LIGLMHGTDEQWTPGYFPQDHPSGSTIMGADPRDSVVDGHCRTHDHENLFIASSSVFST
FT                   VGTGNITLTVAALALRVADMLKRELRHA"
FT                   /protein_id="YP_001831086.1"
FT   misc_feature    110562..112124
FT                   /note="Choline dehydrogenase and related flavoproteins
FT                   [Amino acid transport and metabolism]; Region: BetA;
FT                   COG2303"
FT                   /db_xref="CDD:32458"
FT                   /locus_tag="Bind_3801"
FT   misc_feature    110796..111464
FT                   /note="GMC oxidoreductase; Region: GMC_oxred_N; pfam00732"
FT                   /db_xref="CDD:109776"
FT                   /locus_tag="Bind_3801"
FT   misc_feature    111729..112055
FT                   /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
FT                   /db_xref="CDD:147408"
FT                   /locus_tag="Bind_3801"
FT   gene            112120..113487
FT                   /db_xref="GeneID:6198018"
FT                   /locus_tag="Bind_3802"
FT   CDS_pept        112120..113487
FT                   /locus_tag="Bind_3802"
FT                   /gene_family="HOG000178965" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="PFAM: cytochrome c class I; KEGG: gox:GOX2094
FT                   sorbitol dehydrogenase cytochrome c subunit"
FT                   /db_xref="GI:182676940"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR003219"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="GeneID:6198018"
FT                   /translation="MPDIKSAAFWSFLISGAFLGGTGAHTARAADNDQDLMSRGAYLAT
FT                   AADCVACHTRPSGQPFAGGLKVSTPQGDVVSTNITPDREHGIGDYTEADFEKALRRGIR
FT                   KDGTYLYPVMPYVSYAGLTDQDVRALYIWFMHGVHPVAEKPLETQLRFPANIRMAMGVW
FT                   NLLAGREKQETGDSFQYDKLRRGRYLATALEHCGTCHTPRNFMLIEKQDQYLGGGALAG
FT                   WYAPNITSSKSGGIGDWSEEDLVSYFKTGRAKGRSQAAGPMGEVVEHSTSHLTDEDLDA
FT                   LAAFIKQVPARHNEGVHQARDSFGKPVDTPDLRTGELTRIDDLSERSGAEIYDGNCAAC
FT                   HGQNGAGTADNYVPSLYANSVVGSERPDNLIMTIIYGVDRTTPSGHASMPGFGRNSDVQ
FT                   CLSNEEIARLVNYVTATFGNHDHHVTAEQVAATRTDHLEKMVSHVSVKTTAGSDQR"
FT                   /transl_table="11"
FT                   /protein_id="YP_001831087.1"
FT   sig_peptide     112120..112209
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 30"
FT                   /locus_tag="Bind_3802"
FT   misc_feature    112510..112980
FT                   /note="Cytochrome c, mono- and diheme variants [Energy
FT                   production and conversion]; Region: CccA; COG2010"
FT                   /db_xref="CDD:32193"
FT                   /locus_tag="Bind_3802"
FT   misc_feature    113104..113358
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:187027"
FT                   /locus_tag="Bind_3802"
FT   gene            complement(113582..114361)
FT                   /db_xref="GeneID:6198016"
FT                   /locus_tag="Bind_3803"
FT   CDS_pept        complement(113582..114361)
FT                   /locus_tag="Bind_3803"
FT                   /gene_family="HOG000039983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative insertion sequence transposase-like
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rle:pRL70138 putative insertion sequence
FT                   transposase-like protein"
FT                   /db_xref="GI:182676941"
FT                   /db_xref="InterPro:IPR002345"
FT                   /db_xref="GeneID:6198016"
FT                   /translation="MRLPFVEIAEILNTLVEKFKRQSKDDFKGRHFEAWLILQAVSWYL
FT                   RYPLSYRNIEEMFLERGFEVDHSTLNRWTLAYAPQIEKRLRFFRKPHCGSIRIDETYIK
FT                   IKGQWRYLYRAIGKHGNPVDFLLTAKRDLASAKRFFRKMLKDEPLLAPDRIGTDGAKTF
FT                   PPAIKATEEEGLLRPNPVHRVAKHLQQGIESDHFRVKQNMPKVGCFQSFATARQTIKGF
FT                   EAMLWLRKGFGFACDWTVREQNNLLARCLGLQQLNKA"
FT                   /protein_id="YP_001831088.1"
FT   misc_feature    complement(113669..114283)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bind_3803"
FT   gene            complement(114694..114870)
FT                   /db_xref="GeneID:6198015"
FT                   /locus_tag="Bind_3804"
FT   CDS_pept        complement(114694..114870)
FT                   /locus_tag="Bind_3804"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676942"
FT                   /db_xref="GeneID:6198015"
FT                   /translation="MALVYAVKNNGNSNGRIAVFVDDPRPRQRMETVMLIDGAFTVNTN
FT                   ELTLRRHNIASNP"
FT                   /protein_id="YP_001831089.1"
FT   gene            complement(114861..116858)
FT                   /db_xref="GeneID:6198014"
FT                   /locus_tag="Bind_3805"
FT   CDS_pept        complement(114861..116858)
FT                   /locus_tag="Bind_3805"
FT                   /gene_family="HOG000225954" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transketolase"
FT                   /transl_table="11"
FT                   /note="catalyzes the formation of ribose 5-phosphate and
FT                   xylulose 5-phosphate from sedoheptulose 7-phosphate and
FT                   glyceraldehyde 3-phosphate; can transfer ketol groups
FT                   between several groups; in Escherichia coli there are two
FT                   tkt genes, tktA expressed during exponential growth and the
FT                   tktB during stationary phase"
FT                   /db_xref="GI:182676943"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="GeneID:6198014"
FT                   /translation="MKNSAVHDLMANAVRGLAIDGVEAAKSGHPGAPLGLADVATVLWA
FT                   KHLKFNASKPKWPDRDRFILSAGHASMLIYSLLYLTGVEGMTLDELKRFRQLDSNTPGH
FT                   PEFGHTLGVETTTGPLGQGLATSVGFALAEKKLQAEFSDAIVDHYTFVLASDGDLMEGI
FT                   SHEAIALAGHLKLNKLIMLWDDNGISIDGPLTLSDSVDQVKRFEAAGWRAERIDGHDEQ
FT                   AIDAAIARAKVSTQPSLIACKTVIGFGAPKKAGSHKVHGEPLGPEEIVATKNVLGLSVN
FT                   PFSVQPDALKAWRAMGQRSATEYNDWSARLAALDSDKRVEFVRRTAGTRPASLSQAIEA
FT                   HKKKLHANPVTVATRKASELALEAIFPIMPELISGSADLTPSNNTKAKGFESITPDSWE
FT                   GRYIHYGIREHGMAAAMNGMVLHGGLVPVGGTFFVFSDYCRPAIRLSALMRAPVVYVMT
FT                   HDSIGLGEDGPTHQPVEHLAALRAIPNLRLFRPCDAIETAEAWELALSRTDGPTVIVLT
FT                   RQNLPQLRTVHSAGNLLATGAYELMVSEGEEPQVTIFASGSEVEIAVDAYKLLAAEGIA
FT                   ARVVSIPSLELFLAQPQEVRKALIGSAPIRIAVEAAVRFGWDAVVGEDGLFVGMSSFGA
FT                   SAPSKDLYKHFGITADAIADAVIRSLSRWL"
FT                   /protein_id="YP_001831090.1"
FT   misc_feature    complement(114876..116858)
FT                   /note="transketolase; Reviewed; Region: PRK05899"
FT                   /db_xref="CDD:180309"
FT                   /locus_tag="Bind_3805"
FT   misc_feature    complement(116040..116825)
FT                   /note="Thiamine pyrophosphate (TPP) family, Transketolase
FT                   (TK) subfamily, TPP-binding module; TK catalyzes the
FT                   transfer of a two-carbon unit from ketose phosphates to
FT                   aldose phosphates. In heterotrophic organisms, TK provides
FT                   a link between glycolysis and the...; Region: TPP_TK;
FT                   cd02012"
FT                   /db_xref="CDD:48175"
FT                   /locus_tag="Bind_3805"
FT   misc_feature    complement(order(116079..116081,116289..116291,
FT                   116295..116297,116301..116303,116376..116378,
FT                   116388..116393,116499..116501,116505..116507,
FT                   116652..116654))
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48175"
FT                   /locus_tag="Bind_3805"
FT   misc_feature    complement(order(116244..116246,116289..116294,
FT                   116340..116342,116352..116354,116361..116366,
FT                   116373..116384,116493..116495,116499..116504,
FT                   116541..116543,116547..116552,116574..116576))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48175"
FT                   /locus_tag="Bind_3805"
FT   misc_feature    complement(115305..115793)
FT                   /note="Pyrimidine (PYR) binding domain of
FT                   1-deoxy-D-xylulose-5-phosphate synthase (DXS),
FT                   transketolase (TK), and related proteins; Region:
FT                   TPP_PYR_DXS_TK_like; cd07033"
FT                   /db_xref="CDD:132916"
FT                   /locus_tag="Bind_3805"
FT   misc_feature    complement(order(115332..115334,115398..115403,
FT                   115449..115451,115458..115460,115533..115538,
FT                   115545..115547,115602..115610,115614..115619,
FT                   115626..115643,115647..115649,115656..115658,
FT                   115725..115727,115743..115745,115749..115751))
FT                   /note="PYR/PP interface; other site"
FT                   /db_xref="CDD:132916"
FT                   /locus_tag="Bind_3805"
FT   misc_feature    complement(order(115407..115409,115413..115418,
FT                   115422..115427,115452..115454,115458..115460,
FT                   115539..115541,115545..115550,115632..115640,
FT                   115647..115649,115725..115727))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132916"
FT                   /locus_tag="Bind_3805"
FT   misc_feature    complement(order(115545..115547,115554..115556,
FT                   115632..115634,115638..115640))
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132916"
FT                   /locus_tag="Bind_3805"
FT   misc_feature    complement(114900..115238)
FT                   /note="Transketolase, C-terminal domain; Region:
FT                   Transketolase_C; pfam02780"
FT                   /db_xref="CDD:145764"
FT                   /locus_tag="Bind_3805"
FT   gene            complement(116930..117910)
FT                   /db_xref="GeneID:6198013"
FT                   /locus_tag="Bind_3806"
FT   CDS_pept        complement(116930..117910)
FT                   /locus_tag="Bind_3806"
FT                   /gene_family="HOG000281234" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transaldolase B"
FT                   /EC_number="2.2.1.2"
FT                   /note="KEGG: atc:AGR_L_812 transaldolase; TIGRFAM:
FT                   transaldolase; PFAM: Transaldolase"
FT                   /db_xref="GI:182676944"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="GeneID:6198013"
FT                   /translation="MRPMPNVQKNKLEQLRDMSIIVADTGDIESIRQFMPTDGTTNPSL
FT                   ILRAATNPTYAHLVDEAVAWGRRQVGDRDAIIAATCDRVALNFGTELTKIVPGRVSTEV
FT                   DADLSFNTALLLDKARCLIANYESRGIGRERVLIKLASTWEGIKAAEILEKERINCNLT
FT                   LLFSFAQAVACAQAGVFLISPFVGRIFDWYVKSTGEHYTPDSDPGVLSVARIFKHYKSQ
FT                   GYETIVMGASFRNIGQIEALAGCDRLTIAPGLLEQLAEDTTGVLVRKLDANTVTQSGRE
FT                   GALTEATFRFEHNEDAMATEKLAEGIRLFAEDLNKLRAFIAMKIV"
FT                   /transl_table="11"
FT                   /protein_id="YP_001831091.1"
FT   misc_feature    complement(116933..117883)
FT                   /note="transaldolase-like protein; Provisional; Region:
FT                   PTZ00411"
FT                   /db_xref="CDD:185601"
FT                   /locus_tag="Bind_3806"
FT   misc_feature    complement(116948..117883)
FT                   /note="Transaldolases including both TalA and TalB. The
FT                   enzyme catalyses the reversible transfer of a
FT                   dyhydroxyacetone moiety, derived from fructose-6-phosphate
FT                   to erythrose-4-phosphate yielding sedoheptulose-7-phosphate
FT                   and glyceraldehyde-3-phosphate. The...; Region:
FT                   Transaldolase_TalAB; cd00957"
FT                   /db_xref="CDD:29950"
FT                   /locus_tag="Bind_3806"
FT   misc_feature    complement(order(117347..117349,117362..117364,
FT                   117422..117424,117428..117430,117494..117496,
FT                   117602..117604,117608..117610,117782..117787,
FT                   117791..117793,117839..117841))
FT                   /note="active site"
FT                   /db_xref="CDD:29950"
FT                   /locus_tag="Bind_3806"
FT   misc_feature    complement(order(116987..116989,116999..117001,
FT                   117008..117010,117026..117031,117041..117043,
FT                   117050..117052,117578..117580))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29950"
FT                   /locus_tag="Bind_3806"
FT   misc_feature    complement(117494..117496)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29950"
FT                   /locus_tag="Bind_3806"
FT   gene            complement(118025..119470)
FT                   /db_xref="GeneID:6198012"
FT                   /locus_tag="Bind_3807"
FT   CDS_pept        complement(118025..119470)
FT                   /locus_tag="Bind_3807"
FT                   /gene_family="HOG000222138" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="xylulokinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: bja:bll5785 xylulokinase"
FT                   /db_xref="GI:182676945"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="GeneID:6198012"
FT                   /translation="MFLGIDIGTSAVKSVLVDADERILATASEPLQVSRPQPGWSEQDP
FT                   DSWVSATLTTLDALKMSHGAALARVEGIGLSGQMHGATLLGPDDRPLRPCILWNDGRST
FT                   DECVTLTHAVPELSVITGNLAMSGFTAPKLLWVRQHEPDIFRRIATVLLPKAYVRLALT
FT                   GEKVDEMSDAAGTLWLDVAARDWSNECLAATDLSRAQMPRLIEGSEPSGRLRSELAARY
FT                   GMTTPPVVAGGAGDNAAGAVGLGAIRSGDAFVSLGTSGIVWATTNRFAANPSSAVHAFC
FT                   HALPGLWHQMGVMLSAASCLSWWARIVGRSEADLLAELPRRPSGPGVALFQPYLSGERT
FT                   PHNDASLRGAFAELAHETDRPALTQAVLEGVAYGIRDCLDALSQAGTRVESATVIGGGS
FT                   RTHFWVALLADVLGLPLHRVAQGEVGAAFGAARLGRLAATGESPTAVCRPPAILETIVP
FT                   TPAFTRTYAERYERWRNLYPGRT"
FT                   /protein_id="YP_001831092.1"
FT   misc_feature    complement(118799..119470)
FT                   /note="FGGY family of carbohydrate kinases, N-terminal
FT                   domain; Region: FGGY_N; pfam00370"
FT                   /db_xref="CDD:144091"
FT                   /locus_tag="Bind_3807"
FT   misc_feature    complement(118037..119464)
FT                   /note="D-xylulose kinase; Region: XylB; TIGR01312"
FT                   /db_xref="CDD:162297"
FT                   /locus_tag="Bind_3807"
FT   misc_feature    complement(118202..118717)
FT                   /note="FGGY family of carbohydrate kinases, C-terminal
FT                   domain; Region: FGGY_C; pfam02782"
FT                   /db_xref="CDD:145766"
FT                   /locus_tag="Bind_3807"
FT   gene            complement(119454..120419)
FT                   /db_xref="GeneID:6198011"
FT                   /locus_tag="Bind_3808"
FT   CDS_pept        complement(119454..120419)
FT                   /locus_tag="Bind_3808"
FT                   /gene_family="HOG000160813" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AraC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: mlo:mlr4907 transcriptional regulator
FT                   (AraC/XylS family)"
FT                   /db_xref="GI:182676946"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="GeneID:6198011"
FT                   /translation="MSDRAVKCPELEYIICDSDQSFRWHAHSFPHALARWNYHPEFEIH
FT                   LITRSCGTVFIGDYIGDFAPGHLCLVGANLPHVWVSNIAPGEFIERRDIVLQFDESLLV
FT                   HAAAMFPEFIEIRSFLNLGLRGLEFHGATAKRGAAILQKIGEAHGFHRLTLFFELIDML
FT                   ARSNEKTVLAGVDYAPSLDPRTAKIMEDITSYVLSNLSREVRMVAAAKIAGMTASGFSR
FT                   FFKKNTGRTFVEYVHKLRIGRACRILIETNVPITSICFDVGYNNVSNFNRHFRKERGVT
FT                   PSAYKRMAGQQLLSDPRGLSRQGSFGGRARYQESEDVSRH"
FT                   /protein_id="YP_001831093.1"
FT   misc_feature    complement(119547..119906)
FT                   /note="AraC-type DNA-binding domain-containing proteins
FT                   [Transcription]; Region: AraC; COG2207"
FT                   /db_xref="CDD:32389"
FT                   /locus_tag="Bind_3808"
FT   misc_feature    complement(119565..119675)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Bind_3808"
FT   gene            complement(120412..120693)
FT                   /db_xref="GeneID:6198010"
FT                   /locus_tag="Bind_3809"
FT   CDS_pept        complement(120412..120693)
FT                   /locus_tag="Bind_3809"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676947"
FT                   /db_xref="GeneID:6198010"
FT                   /translation="MGIVMRSHVIKRYWKVKFTLDSALMLRKMHSRSSPSWVKVDYSPD
FT                   DRQSRRNAGRRHCEYNKMIATAQSQHRLRSKDRMVTVHERLLRGRSNV"
FT                   /protein_id="YP_001831094.1"
FT   gene            complement(120695..121741)
FT                   /db_xref="GeneID:6198009"
FT                   /locus_tag="Bind_3810"
FT   CDS_pept        complement(120695..121741)
FT                   /locus_tag="Bind_3810"
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alcohol dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mlo:mlr4915 xylitol (sorbitol) dehydrogenase"
FT                   /db_xref="GI:182676948"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011597"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="GeneID:6198009"
FT                   /translation="MQALVLERKRQLSLRDIDLPLNIGPQDVKIRINTVGICGSDVHYY
FT                   THGHIGPYVVDKPMILGHEASGVIVEVGSAVKDLKPGDRVCMEPGIPNPHSKASKLGLY
FT                   NIDPEVIFWATPPVHGCLTPLVIHPAAFTYKIPENVSFGESAMVEPLAIGLQAATKAKI
FT                   VPGDVALVIGAGTIGIMVALAALAGGCSQVFIADLQQQKLEIASRYVGITPINITQQDL
FT                   VATISDATAGWGVDIVCEASGSAKAYSNLFDAVRPGGAVVFVGCPIEPVTFDIVKAQSK
FT                   EVRMETVFRYANIFDRALNLIASGKVDLKPLISETFPFNRSIEAFDRAAEARATDIKLQ
FT                   IRIDGEFV"
FT                   /protein_id="YP_001831095.1"
FT   misc_feature    complement(120719..121735)
FT                   /note="Sorbitol dehydrogenase; Region: sorbitol_DH;
FT                   cd05285"
FT                   /db_xref="CDD:176188"
FT                   /locus_tag="Bind_3810"
FT   misc_feature    complement(120743..121717)
FT                   /note="L-idonate 5-dehydrogenase; Region: PLN02702"
FT                   /db_xref="CDD:178305"
FT                   /locus_tag="Bind_3810"
FT   misc_feature    complement(order(120872..120877,120944..120946,
FT                   121295..121297,121397..121399,121406..121408,
FT                   121553..121555,121583..121585,121592..121594,
FT                   121610..121612,121622..121624,121628..121630))
FT                   /note="inhibitor binding site; inhibition site"
FT                   /db_xref="CDD:176188"
FT                   /locus_tag="Bind_3810"
FT   misc_feature    complement(order(121295..121297,121550..121555,
FT                   121622..121624,121628..121630))
FT                   /note="catalytic Zn binding site; other site"
FT                   /db_xref="CDD:176188"
FT                   /locus_tag="Bind_3810"
FT   misc_feature    complement(order(121421..121423,121445..121447,
FT                   121454..121456,121463..121465))
FT                   /note="structural Zn binding site; other site"
FT                   /db_xref="CDD:176188"
FT                   /locus_tag="Bind_3810"
FT   misc_feature    complement(order(120872..120880,120944..120952,
FT                   121010..121012,121016..121021,121091..121093,
FT                   121136..121138,121148..121156,121211..121219,
FT                   121283..121285))
FT                   /note="NADP binding site; other site"
FT                   /db_xref="CDD:176188"
FT                   /locus_tag="Bind_3810"
FT   misc_feature    complement(order(120830..120832,120839..120844,
FT                   120851..120853,121058..121060,121094..121096,
FT                   121142..121144,121169..121171,121175..121183,
FT                   121190..121192,121238..121240,121244..121246,
FT                   121277..121279))
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:176188"
FT                   /locus_tag="Bind_3810"
FT   gene            complement(121900..122901)
FT                   /db_xref="GeneID:6198008"
FT                   /locus_tag="Bind_3811"
FT   CDS_pept        complement(121900..122901)
FT                   /locus_tag="Bind_3811"
FT                   /gene_family="HOG000212345" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bvi:Bcep1808_1506
FT                   periplasmic binding protein/LacI transcriptional regulator"
FT                   /db_xref="GI:182676949"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="GeneID:6198008"
FT                   /translation="MKIAAPYSHPDHTIKNNFERNAMIKQLLMGSAILVLAMGAAGAKD
FT                   LKSVGVSVGSLGNLYFVALSQSAEAKAKEINPDVKVITVDSNYDLNKQFNQIDNFIASG
FT                   VDLILLAAADPKAIAPAIKRAQNAGIVVMATDVAAVGADATVQTNNVQAGEIACQYIVD
FT                   KLGAAGGQIIIQNGPQISSIIDRVSGCRKSLANNPKITILSDDQNGKCSRDEGMKIMQG
FT                   HLTRHRKIDAVFTVCDPQATGSDLAAQQFGRNEFFIASVDGAPDIEKAFKGGNTRIQAS
FT                   ASQDPYGMAQQAVQIGYEIMNGKKPDNPMILMPSTLLTKDNVADYKGWSSLR"
FT                   /protein_id="YP_001831096.1"
FT   sig_peptide     complement(122770..122901)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.974 at
FT                   residue 44"
FT                   /locus_tag="Bind_3811"
FT   misc_feature    complement(121909..122823)
FT                   /note="ABC-type sugar transport system, periplasmic
FT                   component [Carbohydrate transport and metabolism]; Region:
FT                   RbsB; COG1879"
FT                   /db_xref="CDD:32063"
FT                   /locus_tag="Bind_3811"
FT   misc_feature    complement(121945..122760)
FT                   /note="Periplasmic sugar-binding domain of uncharacterized
FT                   ABC-type transport systems; Region:
FT                   PBP1_ABC_sugar_binding_like_11; cd06321"
FT                   /db_xref="CDD:107316"
FT                   /locus_tag="Bind_3811"
FT   misc_feature    complement(order(122050..122052,122116..122118,
FT                   122344..122346,122494..122496,122722..122724))
FT                   /note="putative ligand binding site; other site"
FT                   /db_xref="CDD:107316"
FT                   /locus_tag="Bind_3811"
FT   gene            123072..123353
FT                   /db_xref="GeneID:6198007"
FT                   /locus_tag="Bind_3812"
FT   CDS_pept        123072..123353
FT                   /locus_tag="Bind_3812"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676950"
FT                   /db_xref="GeneID:6198007"
FT                   /translation="MIGFSEGRKSHAMADQAGGNDRLGEVIEYEVSQVERQFSTATAED
FT                   FGLTLNEGKGILRQLQAVMVASQMLEFNVASQVCRACYPNKLFIFINL"
FT                   /protein_id="YP_001831097.1"
FT   gene            complement(123471..124173)
FT                   /db_xref="GeneID:6198006"
FT                   /locus_tag="Bind_3813"
FT                   /pseudo
FT   gene            124252..125901
FT                   /db_xref="GeneID:6198005"
FT                   /locus_tag="Bind_3814"
FT   CDS_pept        124252..125901
FT                   /locus_tag="Bind_3814"
FT                   /gene_family="HOG000121685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: smd:Smed_5451 transposase
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="GI:182676951"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="GeneID:6198005"
FT                   /translation="MRKKIHLAFGLGIAVEKIDHREEGWVVSALASGTRSCPGCGVVST
FT                   RRHSWHVRHLQDLPIQGIPVTIALQLGRWRCRNESCSRKTFVEKISTAFPFARRTARVG
FT                   EIIRLFGHAAGGRVGARLLDRLAMPTSHNTVLRHLKRHASASKLKAPLRIAAIDDWSWR
FT                   RGETYGTIIVDLERRTVVDVLPVRSVESTEHWLRQHPGIEIVSRDRCGLYAQAIRQGAP
FT                   QAQQVTDRFHLLQNLREAIERQMERVSRFAGRSLLPAGSDAKREAPRQASREARLALFQ
FT                   NVHELHSAGMPITAIKDKTGLALHTLRQWVRLDDLPARRHPAPTARSPASFKDFLKQQW
FT                   EAGNRCGRHLLHDLRHRGYTGSRSHLYHFIAEWRRLEPDESRNIKASPTPHTPLAETKA
FT                   IDPVTGWQISPKVAAVLCLKPTRLLTPRQALKVKALKQASPSFVTMRALAMRFRGLMRS
FT                   KEPSKLEKWLEKVRHAAILPLQQFAKTLRRDLAAVRNAITQPWSSGQAEGQINRLKTLK
FT                   RTMYGRAGNELLRARMMPFDFVNETVNGMPDP"
FT                   /protein_id="YP_001831098.1"
FT   misc_feature    124351..125343
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3464"
FT                   /db_xref="CDD:33267"
FT                   /locus_tag="Bind_3814"
FT   misc_feature    124717..124995
FT                   /note="Transposase; Region: Transposase_12; pfam01610"
FT                   /db_xref="CDD:110601"
FT                   /locus_tag="Bind_3814"
FT   gene            complement(126419..126703)
FT                   /db_xref="GeneID:6198004"
FT                   /locus_tag="Bind_3815"
FT   CDS_pept        complement(126419..126703)
FT                   /locus_tag="Bind_3815"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676952"
FT                   /db_xref="GeneID:6198004"
FT                   /translation="MARISLLSTYRNGVVKLVDRSAFQIAPDQIHKTADWTQGTELIVQ
FT                   EVQGDDVWTYRLIASCRGIPVKAKPYDGESLPVNQPRAEQQPSVLAANP"
FT                   /protein_id="YP_001831099.1"
FT   gene            126958..127434
FT                   /db_xref="GeneID:6198003"
FT                   /locus_tag="Bind_3816"
FT   CDS_pept        126958..127434
FT                   /locus_tag="Bind_3816"
FT                   /gene_family="HOG000251750" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heat shock protein Hsp20"
FT                   /transl_table="11"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: mlo:mll9627
FT                   small heat shock protein"
FT                   /db_xref="GI:182676953"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="GeneID:6198003"
FT                   /translation="MRTFDVAPLYRSTIGYDRLFDMLDHSTRPDWPPYNIVKKGDNEYC
FT                   ISMAVAGFSPSDISLTQTGTQLLVEGTKRKQPEAYEVLHQGIASRDFKQTFNLADHVKV
FT                   VSADIENGLLMIDFVREVPEALKPRKIEISQTRMEGGAEPKQLKQSDEPVAKAA"
FT                   /protein_id="YP_001831100.1"
FT   misc_feature    126958..127359
FT                   /note="Molecular chaperone (small heat shock protein)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: IbpA; COG0071"
FT                   /db_xref="CDD:30420"
FT                   /locus_tag="Bind_3816"
FT   misc_feature    127051..127317
FT                   /note="Alpha-crystallin domain (ACD) found in Escherichia
FT                   coli inclusion body-associated proteins IbpA and IbpB, and
FT                   similar proteins.  IbpA and IbpB are 16 kDa small heat
FT                   shock proteins (sHsps). sHsps are molecular chaperones that
FT                   suppress protein...; Region: ACD_IbpA-B_like; cd06470"
FT                   /db_xref="CDD:107227"
FT                   /locus_tag="Bind_3816"
FT   misc_feature    order(127057..127071,127096..127098,127102..127104,
FT                   127108..127113,127237..127239,127291..127296)
FT                   /note="putative dimer interface; other site"
FT                   /db_xref="CDD:107227"
FT                   /locus_tag="Bind_3816"
FT   gene            127500..127910
FT                   /db_xref="GeneID:6198002"
FT                   /locus_tag="Bind_3817"
FT   CDS_pept        127500..127910
FT                   /locus_tag="Bind_3817"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: nha:Nham_4549 hypothetical protein"
FT                   /db_xref="GI:182676954"
FT                   /db_xref="GeneID:6198002"
FT                   /translation="MDTEAVFHSSTNVTTLSRCFYDPDEVARDSSLSLNEKREILASWA
FT                   SDARSIKNHPAYRLIESGQIVPLDEILKAIIRLDGESRVQTGHLWRDQKKDDESKSDEI
FT                   DDDDPDDDPPPVPAGGFIPWRPRPPLTPEVAL"
FT                   /protein_id="YP_001831101.1"
FT   gene            complement(128083..128789)
FT                   /db_xref="GeneID:6198001"
FT                   /locus_tag="Bind_3818"
FT                   /pseudo
FT   gene            128883..128984
FT                   /db_xref="GeneID:6198000"
FT                   /locus_tag="Bind_3819"
FT                   /pseudo
FT   gene            complement(129312..129691)
FT                   /db_xref="GeneID:6197998"
FT                   /locus_tag="Bind_3820"
FT                   /pseudo
FT   gene            complement(129729..130008)
FT                   /db_xref="GeneID:6197997"
FT                   /locus_tag="Bind_3821"
FT                   /pseudo
FT   gene            130105..131553
FT                   /db_xref="GeneID:6197996"
FT                   /locus_tag="Bind_3822"
FT   CDS_pept        130105..131553
FT                   /locus_tag="Bind_3822"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hemerythrin HHE cation binding domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: nar:Saro_0180 hemerythrin HHE cation binding region
FT                   protein"
FT                   /db_xref="GI:182676955"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="GeneID:6197996"
FT                   /translation="MKQEKEEKESADPKGQTGAKSSSDVTGEDAKKQDAISMLKADHRE
FT                   IEQLFDRYKAVSRRADRAKIAKEVCNALTIHAILEEEIFYPACRELIDDQPLDEAQVEH
FT                   DSAKVLIEELISGRPEDPFYDAKVNVLAEQVKQHIREEEGKPDSIFAKAEAAGADFVVI
FT                   GEELKKRKAELLSKASRETLQAEPCSFKALANLTKEEDMASYQRGRDYEERGPSRSRYD
FT                   EETGRRRDEQGRFMSNEDYGNRGGQERRYRVGSERDEYSRSSSDRDQGYRSRPSYEDEE
FT                   YSSRGQRMPERDEYGRFVSDDERHGQSYSHGRDYENERRGSRSHGGWFGDPEGHAEAAR
FT                   RGWDEREGEGRAYRDENERRSSSQGSGRRYEQRSRQEEDDERRQGSGRDYEDERRGSRS
FT                   HGGWFGDPEGHAEAARRGWDEREGEGRAYRDENERRSSSQGGGRRYEQRSRQEEDDERH
FT                   QGSGWYGDREGHSEASRRGWEHRR"
FT                   /protein_id="YP_001831102.1"
FT   misc_feature    130282..>130497
FT                   /note="Domain of unknown function (DUF3384); Region:
FT                   DUF3384; pfam11864"
FT                   /db_xref="CDD:152300"
FT                   /locus_tag="Bind_3822"
FT   gene            complement(131736..132608)
FT                   /db_xref="GeneID:6197995"
FT                   /locus_tag="Bind_3823"
FT   CDS_pept        complement(131736..132608)
FT                   /locus_tag="Bind_3823"
FT                   /gene_family="HOG000246946" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transglutaminase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   rle:RL1406 putative transglutaminase family protein"
FT                   /db_xref="GI:182676956"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="GeneID:6197995"
FT                   /translation="MLIRYGYELTLNCQQPTFMLCMLDAHRERAHHIRYETPVITTPQI
FT                   DSSTYIDLYGNHVRRLIAPAGDLAICCDAVIDDSGLPDPVVLDAQEVVMEQIPSNYLVY
FT                   LLGSRYCETDKLGDIAWQLFGSTPRGWHRVQAICDFVCDHLTFGYEYARATRTAYEAFE
FT                   ERKGVCRDFAHLAVTFCRCMNIPARYTNGFLGDIGVPSNPTPMDYNAWFEVYLDGGWFT
FT                   FDARHNTPRIGRIPVARGRDAIDVAMVTSFGPHSLTRFRVWTEEINEGVLQDLIAASLE
FT                   SEALAFHRN"
FT                   /protein_id="YP_001831103.1"
FT   misc_feature    complement(131814..132608)
FT                   /note="Transglutaminase-like enzymes, putative cysteine
FT                   proteases [Amino acid transport and metabolism]; Region:
FT                   COG1305"
FT                   /db_xref="CDD:31496"
FT                   /locus_tag="Bind_3823"
FT   misc_feature    complement(131934..132212)
FT                   /note="Transglutaminase-like superfamily; Region:
FT                   Transglut_core; cl10469"
FT                   /db_xref="CDD:176834"
FT                   /locus_tag="Bind_3823"
FT   gene            132856..133092
FT                   /db_xref="GeneID:6197994"
FT                   /locus_tag="Bind_3824"
FT                   /pseudo
FT   gene            133117..133731
FT                   /db_xref="GeneID:6197993"
FT                   /locus_tag="Bind_3825"
FT   CDS_pept        133117..133731
FT                   /locus_tag="Bind_3825"
FT                   /gene_family="HOG000141232" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="isochorismatase hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: mex:Mext_0062
FT                   isochorismatase hydrolase"
FT                   /db_xref="GI:182676957"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="GeneID:6197993"
FT                   /translation="MAMNRNELRFGRLSCSSRHICVDIQKLFAEETDWRTPWMDRVLPS
FT                   VYQLVAHHPSQTIFTRFIPAEHAGQGIGTWRRYYERWSSMTIESLGIAMIDLVAELAAL
FT                   VPPAEVLDKHVYSPWFESDLHARLQHQSVDTLIISGGETDVCVLSTVLGAVDRGYRVVL
FT                   ASDALCSSSDEAHDAAIRVYETRYSQQVEVVTTNLILENWK"
FT                   /protein_id="YP_001831104.1"
FT   misc_feature    133171..133704
FT                   /note="Isochorismatase family; Region: Isochorismatase;
FT                   pfam00857"
FT                   /db_xref="CDD:144449"
FT                   /locus_tag="Bind_3825"
FT   misc_feature    133171..133659
FT                   /note="Cysteine hydrolases; This family contains
FT                   amidohydrolases, like CSHase (N-carbamoylsarcosine
FT                   amidohydrolase), involved in creatine metabolism and
FT                   nicotinamidase, converting nicotinamide to nicotinic acid
FT                   and ammonia in the pyridine nucleotide cycle. It...;
FT                   Region: cysteine_hydrolases; cd00431"
FT                   /db_xref="CDD:29548"
FT                   /locus_tag="Bind_3825"
FT   misc_feature    order(133183..133185,133453..133455,133552..133554)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:29548"
FT                   /locus_tag="Bind_3825"
FT   misc_feature    133537..133542
FT                   /note="conserved cis-peptide bond; other site"
FT                   /db_xref="CDD:29548"
FT                   /locus_tag="Bind_3825"
FT   gene            complement(133865..134689)
FT                   /db_xref="GeneID:6197992"
FT                   /locus_tag="Bind_3826"
FT   CDS_pept        complement(133865..134689)
FT                   /locus_tag="Bind_3826"
FT                   /gene_family="HOG000057756" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bja:bll5207 hypothetical protein"
FT                   /db_xref="GI:182676958"
FT                   /db_xref="GeneID:6197992"
FT                   /translation="MDNTNLRPVAAVPMTEVLASSYLGWPAIIAGALVGTAIFVTLTPF
FT                   GSAIGLAITSPYLGQGLSAKATVIAITIWTLWVVVSSYIAAGYIAGRMRHVTPDVSTYE
FT                   SEIRDGAHGLIAWALTTLLVGVIVSTALSDIVREAQSKTPEQTDHSLYMADALLRGERL
FT                   ETPYNEGLRREVAAILQSGVYNGAVTASDRDYLVRLVTDRGLTPVDAQKRVDYAITDVR
FT                   DTANAKRKVGILAAFLSAAASAIGAAAAWWAATIGGQHRKNYAGVSIFTRWR"
FT                   /protein_id="YP_001831105.1"
FT   gene            135362..135811
FT                   /db_xref="GeneID:6197991"
FT                   /locus_tag="Bind_3827"
FT   CDS_pept        135362..135811
FT                   /locus_tag="Bind_3827"
FT                   /gene_family="HOG000025592" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF892; KEGG:
FT                   rpe:RPE_1822 protein of unknown function DUF892"
FT                   /db_xref="GI:182676959"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="GeneID:6197991"
FT                   /translation="MVQSGGNLQDLFHRELKDIYFAEKQILRALPKMARNARSSELQHA
FT                   FETHADETEQQIERLDRVFESIGQLPRGKICDAIIGLLDEGKEIMEEFADTEALDPGLL
FT                   AAAQSVEHYEISRYGTLKAWADQLGPVDKSRQPDFCGGDGEKFEE"
FT                   /protein_id="YP_001831106.1"
FT   misc_feature    135386..135748
FT                   /note="YciF bacterial stress response protein,
FT                   ferritin-like iron-binding domain; Region: YciF; cd07909"
FT                   /db_xref="CDD:153118"
FT                   /locus_tag="Bind_3827"
FT   misc_feature    order(135401..135403,135413..135415,135587..135595,
FT                   135602..135604,135614..135616,135629..135631,
FT                   135674..135679,135683..135685,135698..135700,
FT                   135710..135712,135719..135721)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:153118"
FT                   /locus_tag="Bind_3827"
FT   misc_feature    order(135428..135430,135506..135508,135518..135520,
FT                   135527..135529,135692..135694,135701..135703,
FT                   135713..135715)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:153118"
FT                   /locus_tag="Bind_3827"
FT   gene            complement(135743..136524)
FT                   /note="ribosomal slippage"
FT                   /db_xref="GeneID:6197990"
FT                   /locus_tag="Bind_3828"
FT   CDS_pept        complement(join(135743..136195,136195..136524))
FT                   /locus_tag="Bind_3828"
FT                   /gene_family="HOG000254172" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /ribosomal_slippage
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2729 transposase"
FT                   /db_xref="GI:182676960"
FT                   /db_xref="GeneID:6197990"
FT                   /translation="MNRGDLSDAEWAIIEALLPPERGRWARPAQDNRRFLNGMLFVLRA
FT                   GCPWRDMHERYGKWNSVYVRFRRWAEQGVWDALLETLVELGLADDWQHMIDSTIVRGHS
FT                   QAAGAKRGTHKEGFGRSRGGFTSKIHARADSHGRPLGFVLTSGETSDYAATPALLGMPV
FT                   AKPKAMLADKGYDSDEVRASLLLKGILPVIPPKANRKESVSYDFKLYKDRNRIERMFNR
FT                   LKQFRRIATRYDKTAVSFLKFLAIAAAKIWLPTFVNRT"
FT                   /protein_id="YP_001831107.1"
FT   misc_feature    complement(join(136151..136195,136195..136524))
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3293"
FT                   /db_xref="CDD:33102"
FT                   /locus_tag="Bind_3828"
FT   misc_feature    complement(join(135767..136195,136195..136242))
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="Bind_3828"
FT   misc_feature    complement(135767..136147)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3293"
FT                   /db_xref="CDD:33102"
FT                   /locus_tag="Bind_3828"
FT   gene            complement(136826..137332)
FT                   /db_xref="GeneID:6197989"
FT                   /locus_tag="Bind_3829"
FT   CDS_pept        complement(136826..137332)
FT                   /locus_tag="Bind_3829"
FT                   /gene_family="HOG000268354" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF892; KEGG:
FT                   smd:Smed_4046 protein of unknown function DUF892"
FT                   /db_xref="GI:182676961"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="GeneID:6197989"
FT                   /translation="MATAEEHLVEWLRDAHAMEQQAETMLSSFAGRVENYPDLKSRIER
FT                   HLEETRQQVQIIRRCIVRRGGDTSTIKDLAAKFVAMTQGFGGVFAGDEVIKGSMASYSF
FT                   EEVEIASYTVLIAAAEALGDHETRSACEAILAQEENMAQWLRAHLPEITTQYLRREAMH
FT                   LEEQH"
FT                   /protein_id="YP_001831108.1"
FT   misc_feature    complement(136862..137326)
FT                   /note="Ferritin-like superfamily of diiron-containing
FT                   four-helix-bundle proteins; Region: Ferritin_like; cl00264"
FT                   /db_xref="CDD:185872"
FT                   /locus_tag="Bind_3829"
FT   gene            137667..138610
FT                   /note="ribosomal slippage"
FT                   /db_xref="GeneID:6197988"
FT                   /locus_tag="Bind_3830"
FT   CDS_pept        join(137667..138011,138011..138610)
FT                   /locus_tag="Bind_3830"
FT                   /gene_family="HOG000228640" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /ribosomal_slippage
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="KEGG: acr:Acry_3597 transposase and inactivated
FT                   derivatives-like protein"
FT                   /db_xref="GI:182676962"
FT                   /db_xref="GeneID:6197988"
FT                   /translation="MGHALSMDLRSRLLAAIDGGMSCRAAATRFGVAPSTAIRWQAQRR
FT                   ETGDYSPKPQGGDMRSHRIEARRADILAVWETRKDISLEELRLVLIEIGLTVSVAALHR
FT                   FFVRHGMTRKKKTGHAIEQDRPDILKQRRHWFDGQLDLESERLVFIDETWTATNMTRSH
FT                   GRCAKGERLRMGFPHGHRKTTTLVAGLRTSGMVAPMVLDGPINGDWFEAYVTQILVPEL
FT                   RRGDIVIMDNLSSHKRVSVRERIEAAGVALLFLPPYSPDFNPIEKAFARLKAMLRKIGE
FT                   RTVSGLWKLIGKLVDIFRPDECANYFRSCGYDP"
FT                   /protein_id="YP_001831109.1"
FT   misc_feature    join(137667..138011,138011..138049)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3415"
FT                   /db_xref="CDD:33221"
FT                   /locus_tag="Bind_3830"
FT   misc_feature    join(137676..138011,138011..138013)
FT                   /note="Transposase; Region: Transposase_14; pfam01710"
FT                   /db_xref="CDD:145062"
FT                   /locus_tag="Bind_3830"
FT   misc_feature    138212..138601
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bind_3830"
FT   gene            138735..139240
FT                   /db_xref="GeneID:6197987"
FT                   /locus_tag="Bind_3831"
FT                   /pseudo
FT   gene            complement(139296..139636)
FT                   /db_xref="GeneID:6197986"
FT                   /locus_tag="Bind_3832"
FT                   /pseudo
FT   gene            139994..140524
FT                   /db_xref="GeneID:6197985"
FT                   /locus_tag="Bind_3833"
FT   CDS_pept        139994..140524
FT                   /locus_tag="Bind_3833"
FT                   /gene_family="HOG000187685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bra:BRADO3437 hypothetical protein"
FT                   /db_xref="GI:182676963"
FT                   /db_xref="GeneID:6197985"
FT                   /translation="MKHLILAIAYLVSMSPVSAQSLGEKAGVNSLMDASLSTEDFVKEA
FT                   ATSDMFEIQSSELALQKSTDTAIKNFAQQMVQDHSMTTSDLKAFVESGKVKATIPDQLD
FT                   QSHQSKLDKLKTLTGTDFDKQYDKDQTTGHKDAVSLFKRYAEGGENAELKIWASKTLPK
FT                   LEDHLKEAKALRP"
FT                   /protein_id="YP_001831110.1"
FT   sig_peptide     139994..140053
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 20"
FT                   /locus_tag="Bind_3833"
FT   misc_feature    140114..140518
FT                   /note="Predicted outer membrane protein [Function unknown];
FT                   Region: COG3652"
FT                   /db_xref="CDD:33450"
FT                   /locus_tag="Bind_3833"
FT   gene            140808..141998
FT                   /db_xref="GeneID:6197984"
FT                   /locus_tag="Bind_3834"
FT   CDS_pept        140808..141998
FT                   /locus_tag="Bind_3834"
FT                   /gene_family="HOG000228264" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NADH dehydrogenase subunit D"
FT                   /EC_number="1.6.99.3"
FT                   /note="Catalyzes the transfer of electrons from NADH to
FT                   quinone"
FT                   /db_xref="GI:182676964"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR010219"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="GeneID:6197984"
FT                   /translation="MDEAGFRNFTVNFGPQHPAAHGVLRLVLELDGEVVERADPHIGLL
FT                   HRGTEKLIEYRTYLQALPYFDRLDYVAPMNQEHAFCLAIEKLLQMPVPRRGQLIRVLFC
FT                   EIGRLLSHLLNITTQALDIGALTPPLWGFEEREKLMVFYERASGARMHANYFRVGGVHQ
FT                   DLPEKLLDDIWNFCEPFLKVCNDLEELLSYNRIFKQRNVDVGVISLDEAWTRGFSGVMV
FT                   RGSGAAWDLRKAQPYECYDELQFDIPVGKHGDCYDRYLIRMEEMRQSVRIMKQCLEKLS
FT                   SVDGKGPIIEQNHKVTPPRRSEMKRSMEALIQHFKLYTEGHHVPAGEVYAAVEAPKGEF
FT                   GVYLISDGSNIPYRCKIRAPSFAHLQAIDFLSHKHMLADVSAIIGSLDIVFGEIDR"
FT                   /transl_table="11"
FT                   /protein_id="YP_001831111.1"
FT   misc_feature    140814..141995
FT                   /note="Respiratory-chain NADH dehydrogenase, 49 Kd subunit;
FT                   Region: Complex1_49kDa; cl00417"
FT                   /db_xref="CDD:185984"
FT                   /locus_tag="Bind_3834"
FT   gene            complement(142166..145669)
FT                   /db_xref="GeneID:6197983"
FT                   /locus_tag="Bind_3835"
FT   CDS_pept        complement(142166..145669)
FT                   /locus_tag="Bind_3835"
FT                   /gene_family="HOG000062543" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MCP methyltransferase/methylesterase, CheR/CheB
FT                   with PAS/PAC sensor"
FT                   /EC_number="3.1.1.61"
FT                   /EC_number="2.1.1.80"
FT                   /note="KEGG: sme:SMb20515 putative chemotaxis
FT                   methyltransferase protein; TIGRFAM: PAS sensor protein;
FT                   PFAM: CheB methylesterase; MCP methyltransferase CheR-type;
FT                   HWE histidine kinase; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="GI:182676965"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:6197983"
FT                   /translation="MEDHNQNLSIVGIGASAGGVKALQTFFEALHTETDAAFVIIVHLD
FT                   PEVPSELAAILANHTKMPVAQIDNTALLEGGHVYVIAPNRRLHIADHLVTALPLDEPRS
FT                   QRAPIDWFFRSLADQHSNCYAVILTGAGTDGAIGVKAIKEAGGIVLVQDPEEAEYGSMP
FT                   RSAIATQVADFVLPVRDLAKRLNELLAHHTQVPLLSPQEQNEDLLRRILAHVRIRTGHD
FT                   FSQYKRATLLRRIARRAQVMRKESLADYYLYLRDNAEEAQALFGDFLISVTTFFRDPKA
FT                   FATLVQTAIPQLFESKEAGSTIRVWVPGCATGEEAYTIGILLLEEASRHEIRPEIQVFG
FT                   SDLDTGALAIAREGRFPATIETDLTEERLRRFFQREGDHYRVRRELRDIVLFANHSLLK
FT                   DPPFSRLDMISCRNLLIYMDRELQQQVCNTFHYALNPGGFLFLGSSESAEQPSGLFRPI
FT                   DREARLYRAVPTPNERRPALPILLSSYPIADRGPTTTRVPSHGGNIADAALHRQMLEKI
FT                   APPSMLVDMSHRAIHLSENAGRYLHLSGGPVSTDAADMVREEFRFDLRTALHRAFERGE
FT                   STLSMPLVVRFNGVPHRVYLQVKPVVQDDDATAYALVLFIEGDSVEQEVTEEHNGTSRT
FT                   HEPVNETIQQLQQELQLAQSRLRVTREESEATNEELRAANEELQSINEEYRSTSEELET
FT                   SKEELQSINEELQTVNNELKLKLETVSRAHNDLQNLMSATDVGTLFLDPSLRIKRFTPR
FT                   LTDLFNITAHDEGRPITDFTHQLDYDELADHARMVLRDLTPIEQEVKSRKGGWYLVRMR
FT                   PYRTIDDKIEGVVATFVDITERLRAEEALRESEEHLRQEMRLVELSRAPIFVWDFDNGI
FT                   VQWNRGCEQLYGYSREEAIGKRKESLLKTIVPGSSFEALRQSLLENGSWSGELFHTAKN
FT                   GNVLSVESQIELVSLGGRRLVLESTWDLTERKRWEQRRQLLLDELTHRMKNTLTVIQSI
FT                   AHQTLRTTTSGADFVERFEGRLHALANAHKLLVESRWEGAELGALAQGQLEAYIGNDSG
FT                   KLRIEGESVILPPEIATPFGLVLHELATNAVKYGALSAPTGRVVLSWTLSARGDRKYLS
FT                   VNWKECDGPRVVAPENRGFGGILIENGVPGATVKRNFLPEGVTCTIDLELPEIQWNGSH
FT                   D"
FT                   /transl_table="11"
FT                   /protein_id="YP_001831112.1"
FT   misc_feature    complement(145106..145642)
FT                   /note="CheB methylesterase; Region: CheB_methylest;
FT                   pfam01339"
FT                   /db_xref="CDD:144802"
FT                   /locus_tag="Bind_3835"
FT   misc_feature    complement(144263..145057)
FT                   /note="Methylase of chemotaxis methyl-accepting proteins
FT                   [Cell motility and secretion / Signal transduction
FT                   mechanisms]; Region: CheR; COG1352"
FT                   /db_xref="CDD:31543"
FT                   /locus_tag="Bind_3835"
FT   misc_feature    complement(144275..144856)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:187159"
FT                   /locus_tag="Bind_3835"
FT   misc_feature    complement(143177..143470)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bind_3835"
FT   misc_feature    complement(142775..143461)
FT                   /note="FOG: PAS/PAC domain [Signal transduction
FT                   mechanisms]; Region: AtoS; COG2202"
FT                   /db_xref="CDD:32384"
FT                   /locus_tag="Bind_3835"
FT   misc_feature    complement(order(143264..143266,143345..143356,
FT                   143390..143392,143408..143410,143420..143422))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bind_3835"
FT   misc_feature    complement(order(143237..143239,143243..143245,
FT                   143315..143320,143327..143329,143351..143353,
FT                   143363..143365))
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bind_3835"
FT   misc_feature    complement(142928..143113)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cl02459"
FT                   /db_xref="CDD:141436"
FT                   /locus_tag="Bind_3835"
FT   misc_feature    complement(142190..142819)
FT                   /note="Signal transduction histidine kinase [Signal
FT                   transduction mechanisms]; Region: COG3920"
FT                   /db_xref="CDD:33706"
FT                   /locus_tag="Bind_3835"
FT   misc_feature    complement(142502..142750)
FT                   /note="Histidine kinase; Region: HisKA_2; cl06527"
FT                   /db_xref="CDD:157259"
FT                   /locus_tag="Bind_3835"
FT   gene            145882..146865
FT                   /db_xref="GeneID:6197982"
FT                   /locus_tag="Bind_3836"
FT   CDS_pept        145882..146865
FT                   /locus_tag="Bind_3836"
FT                   /gene_family="HOG000224650" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CheB methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; KEGG: smd:Smed_5775 CheB
FT                   methylesterase"
FT                   /db_xref="GI:182676966"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="GeneID:6197982"
FT                   /translation="MSQRDIIAIGGSLGAVEAVKNLFRDLPPGIDATILIVIHVGTVGN
FT                   NYLADIFDEEASIPVTMARDGEKLKRGHAYVAPADHHLLVMGNHIRLGRGPRENMARPA
FT                   IDPLFRSIAVSHGSRTVAVVLTGLLNDGAAGLADVKRCGGVTVVQNPREATAPQMPLEA
FT                   LKTGYVDYIIPLEELGNLLKKLTKEEAGQSNEIPEGLLFEVEIALGYKTGIKKNAKIAD
FT                   VVPLSCPACGGVLSQLKIGLPLRFRCQTGHAYTAETLINVKEGAVDEALRVALRMIEER
FT                   VFLCEKMAEDARRSDRHAAAKIAEERMQEYKDYADLLRRTLLGKNY"
FT                   /transl_table="11"
FT                   /protein_id="YP_001831113.1"
FT   misc_feature    145897..146436
FT                   /note="CheB methylesterase; Region: CheB_methylest;
FT                   pfam01339"
FT                   /db_xref="CDD:144802"
FT                   /locus_tag="Bind_3836"
FT   gene            147543..147782
FT                   /db_xref="GeneID:6197981"
FT                   /locus_tag="Bind_3837"
FT   CDS_pept        147543..147782
FT                   /locus_tag="Bind_3837"
FT                   /gene_family="HOG000032186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rpe:RPE_1591 hypothetical protein"
FT                   /db_xref="GI:182676967"
FT                   /db_xref="GeneID:6197981"
FT                   /translation="MRVYAFVIFTAAFFVLPIATFAQEVELGPGGVRVEPFHQGRSAWH
FT                   PNCGELRRACLYKEELGEEGRGNCERYRHFCRSH"
FT                   /protein_id="YP_001831114.1"
FT   sig_peptide     147543..147611
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.985 at
FT                   residue 23"
FT                   /locus_tag="Bind_3837"
FT   gene            complement(147789..148270)
FT                   /db_xref="GeneID:6197980"
FT                   /locus_tag="Bind_3838"
FT                   /pseudo
FT   gene            complement(148314..148591)
FT                   /db_xref="GeneID:6197979"
FT                   /locus_tag="Bind_3839"
FT                   /pseudo
FT   gene            complement(148601..148911)
FT                   /db_xref="GeneID:6197978"
FT                   /locus_tag="Bind_3840"
FT                   /pseudo
FT   gene            149143..149774
FT                   /db_xref="GeneID:6197977"
FT                   /locus_tag="Bind_3841"
FT                   /pseudo
FT   gene            150469..150930
FT                   /db_xref="GeneID:6197976"
FT                   /locus_tag="Bind_3842"
FT   CDS_pept        150469..150930
FT                   /locus_tag="Bind_3842"
FT                   /gene_family="HOG000221033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1348; KEGG:
FT                   rle:RL1427 hypothetical protein"
FT                   /db_xref="GI:182676968"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="GeneID:6197976"
FT                   /translation="MSALVPPFTFETATAKVRFAEDAWNSQDAHRVCLAYTEDSLWRNR
FT                   TEFFSGREAIIAFLQRKWTQELDYRLIKELWIYTEHRLAVRFAYEWRDMTGQWFRSYGN
FT                   ENWDFDEAGLMRRRFASINDLPIAASERKFDWRLGRRPDEHPGLSDLGL"
FT                   /protein_id="YP_001831115.1"
FT   misc_feature    150478..150900
FT                   /note="Protein of unknown function (DUF1348); Region:
FT                   DUF1348; pfam07080"
FT                   /db_xref="CDD:115716"
FT                   /locus_tag="Bind_3842"
FT   gene            complement(151002..151769)
FT                   /db_xref="GeneID:6197975"
FT                   /locus_tag="Bind_3843"
FT   CDS_pept        complement(151002..151769)
FT                   /locus_tag="Bind_3843"
FT                   /gene_family="HOG000057769" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hch:HCH_04879 hypothetical protein"
FT                   /db_xref="GI:182676969"
FT                   /db_xref="GeneID:6197975"
FT                   /translation="MFMPATQSFSYEAVNALKLDAIEAKYAWIVEPIYRASESVKRMPF
FT                   YTYIANMTSPQDFKPVATQLYFHSATFPKVMGLMLGLTPLSQNYMMPFYAKHAFGEADH
FT                   HQMLLRWMVKHELLQDAADINGVITAVETNACVNLAYQLAAEQDRDKWLVTINSGIERC
FT                   SNDFFKMVAPKMHELGVGDVYFDLHVEADEHHSIMGLEFLEACDPESPRGKQLIAKALE
FT                   GVALWADMLHAWIGLDYHPRFNLDGSLSTGSRV"
FT                   /protein_id="YP_001831116.1"
FT   misc_feature    complement(<151101..>151466)
FT                   /note="recombination and repair protein; Provisional;
FT                   Region: PRK10869"
FT                   /db_xref="CDD:182794"
FT                   /locus_tag="Bind_3843"
FT   gene            152123..152776
FT                   /db_xref="GeneID:6197974"
FT                   /locus_tag="Bind_3844"
FT   CDS_pept        152123..152776
FT                   /locus_tag="Bind_3844"
FT                   /gene_family="HOG000042716" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="XRE family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   smd:Smed_1854 putative phage repressor"
FT                   /db_xref="GI:182676970"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:6197974"
FT                   /translation="MELFHRLRRARKNAGFPSATEAARAFGWNANTYRSHENGERGVRM
FT                   AMAERYAKAFRVSVPWLLTGMPHPDARCVACLAGRVVAQGRIETHRPGGSPLSCKNIML
FT                   PYPVPEGALVFEITGDHLWPRYESGDVVVCWKPARTLQEADGWEAAVKLADGQIYLKTV
FT                   RYREGHQADLVSHNSAPLVNKHVTHAQKVFGSIRADAWSELPQADSEDGLQGDV"
FT                   /protein_id="YP_001831117.1"
FT   misc_feature    152138..152308
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bind_3844"
FT   misc_feature    order(152144..152146,152156..152158,152234..152236)
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bind_3844"
FT   misc_feature    152147..152713
FT                   /note="Predicted transcriptional regulator [Transcription];
FT                   Region: COG2932"
FT                   /db_xref="CDD:32756"
FT                   /locus_tag="Bind_3844"
FT   misc_feature    order(152153..152155,152231..152233)
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bind_3844"
FT   misc_feature    order(152177..152182,152213..152215,152222..152224,
FT                   152234..152239)
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bind_3844"
FT   misc_feature    152462..>152659
FT                   /note="Peptidase S24 LexA-like proteins are involved in the
FT                   SOS response leading to the repair of single-stranded DNA
FT                   within the bacterial cell. This family includes: the lambda
FT                   repressor CI/C2 family and related bacterial prophage
FT                   repressor proteins; LexA...; Region: S24_LexA-like;
FT                   cd06529"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="Bind_3844"
FT   misc_feature    order(152483..152485,152603..152605)
FT                   /note="Catalytic site; other site"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="Bind_3844"
FT   gene            complement(153004..153585)
FT                   /db_xref="GeneID:6197973"
FT                   /locus_tag="Bind_3845"
FT   CDS_pept        complement(153004..153585)
FT                   /locus_tag="Bind_3845"
FT                   /gene_family="HOG000221481" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: nwi:Nwi_3052
FT                   transcriptional regulatory protein, TetR family"
FT                   /db_xref="GI:182676971"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:6197973"
FT                   /translation="MWTTDNQAKQILAVATSLFRSDGYAATDIEEISARCSVVPQEIYD
FT                   IFENKAMLALAVMDYIQNLFDTQILNYAYDKQVSAHERMTNLNKAIEAYFTNSKGGCIF
FT                   INFGIEQMHREPIFVEPIKRYFLSLKEAYTAILLDRYGAEEALEIADTLVADLQGALIM
FT                   VRINGDIWPIQRLTDRFQVHLQQGGSNRES"
FT                   /protein_id="YP_001831118.1"
FT   misc_feature    complement(153070..153561)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="Bind_3845"
FT   misc_feature    complement(153415..153555)
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Bind_3845"
FT   gene            complement(154232..154642)
FT                   /db_xref="GeneID:6197972"
FT                   /locus_tag="Bind_3846"
FT   CDS_pept        complement(154232..154642)
FT                   /locus_tag="Bind_3846"
FT                   /gene_family="HOG000057674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676972"
FT                   /db_xref="GeneID:6197972"
FT                   /translation="MPQSSLEQIQAEIAAIEERIDNLRLVEEILAELEGKASRKPVHRE
FT                   SRKIAVKSQKPRKTKASLLSARPSEPQGREGSTPNAVLALLEAEGPLARAEIEQAIRAD
FT                   RDLSKQTISVALQRLKGAGKVHLDGGKWSLRA"
FT                   /protein_id="YP_001831119.1"
FT   gene            complement(154690..155973)
FT                   /db_xref="GeneID:6197971"
FT                   /locus_tag="Bind_3847"
FT   CDS_pept        complement(154690..155973)
FT                   /locus_tag="Bind_3847"
FT                   /gene_family="HOG000275563" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="replication protein C"
FT                   /transl_table="11"
FT                   /note="PFAM: replication protein C; KEGG: acr:Acry_3578
FT                   replication protein C"
FT                   /db_xref="GI:182676973"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="GeneID:6197971"
FT                   /translation="MSTGISHSPRPSGLRRISPAMLAFRETADTYQGLPDGSLKPFQFL
FT                   TAFQQALPYLRLPPKAFELVAWLFDMTHACDWQQGSKPIAWPSARLQQEYLGLSAARVK
FT                   VLNRALFEAGIFVIRDNAEGKRYGQRGPDGRILQAFGFDLSPLAQRYAEFLRIAEEAKI
FT                   ERALVRSCRRQLTLVRKAILQAEAILKDSQDVLPEVTAWLAERDRLDLACRRVQVSKDL
FT                   RDLLSQMQDVQTGLEDLIKSEREQQKQTKTSPAGLENEPHIDTNTTLTHYPSKDTVIAS
FT                   KRRSRPRPEAPASSFKVRTKPQEGANGKKGGLTQPAELLDLAPELGQWVGTSSPDWPDV
FT                   IGAAGGPLRHSLGVSTTLWAQACRVMGREDATLALALVSVKPEDYFSSGPAGYFGGMVK
FT                   KAEKGELFLERSLWALREAKWGKRPWNH"
FT                   /protein_id="YP_001831120.1"
FT   misc_feature    complement(155428..155931)
FT                   /note="Replication protein C N-terminal domain; Region:
FT                   RP-C; pfam03428"
FT                   /db_xref="CDD:146192"
FT                   /locus_tag="Bind_3847"
FT   misc_feature    complement(154717..>155019)
FT                   /note="Replication protein C C-terminal region; Region:
FT                   RP-C_C; pfam11800"
FT                   /db_xref="CDD:152236"
FT                   /locus_tag="Bind_3847"
FT   gene            complement(156275..156835)
FT                   /db_xref="GeneID:6197970"
FT                   /locus_tag="Bind_3848"
FT   CDS_pept        complement(156275..156835)
FT                   /locus_tag="Bind_3848"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nuclease"
FT                   /transl_table="11"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   mex:Mext_0065 nuclease (SNase domain protein)"
FT                   /db_xref="GI:182676974"
FT                   /db_xref="InterPro:IPR006021"
FT                   /db_xref="GeneID:6197970"
FT                   /translation="MNFPLREQAICSIFFFAFTQVPANAQISEHNEQALVSDIKASVID
FT                   GDTFRDPRDGQSYRLFGIDACEKDQDAYTSLGQAWPCGAVATTWLASHVVGRAVTCTII
FT                   KPDIYGRKLAKCGTEETPDLGAAMVQEGQAVVYRFYGRPTEPAYLPLEAKAQTEHRGIW
FT                   QGAVQDPAAWRHDHHAHHDQAVE"
FT                   /protein_id="YP_001831121.1"
FT   sig_peptide     complement(156758..156835)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.964 at
FT                   residue 26"
FT                   /locus_tag="Bind_3848"
FT   misc_feature    complement(156347..156736)
FT                   /note="Staphylococcal nuclease homologues; Region: SNc;
FT                   smart00318"
FT                   /db_xref="CDD:128613"
FT                   /locus_tag="Bind_3848"
FT   misc_feature    complement(156347..156712)
FT                   /note="Staphylococcal nuclease homologues. SNase homologues
FT                   are found in bacteria, archaea, and eukaryotes. They
FT                   contain no disufide bonds; Region: SNc; cd00175"
FT                   /db_xref="CDD:29137"
FT                   /locus_tag="Bind_3848"
FT   misc_feature    complement(order(156503..156505,156509..156514,
FT                   156635..156637,156644..156646,156662..156664,
FT                   156695..156697))
FT                   /note="Catalytic site; other site"
FT                   /db_xref="CDD:29137"
FT                   /locus_tag="Bind_3848"
FT   gene            157417..157806
FT                   /db_xref="GeneID:6197969"
FT                   /locus_tag="Bind_3849"
FT   CDS_pept        157417..157806
FT                   /locus_tag="Bind_3849"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676975"
FT                   /db_xref="GeneID:6197969"
FT                   /translation="MREEKDKAGVFDIAHYPAQRMPSTIIKEDDELIRICELICEFSVH
FT                   WNYTLNTDNLDTQGESETIDLLNSRLFQPLLRIIELKSSSELGVAAKEQVLAAYKKILP
FT                   HNFIDTYAEHLINSINSDIRSISYK"
FT                   /protein_id="YP_001831122.1"
FT   gene            157937..159001
FT                   /db_xref="GeneID:6197968"
FT                   /locus_tag="Bind_3850"
FT   CDS_pept        157937..159001
FT                   /locus_tag="Bind_3850"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2606 hypothetical protein"
FT                   /db_xref="GI:182676976"
FT                   /db_xref="GeneID:6197968"
FT                   /translation="MRSIPVALFCLMPFAAAGSDLSELKQPSERVVEEPTLPPLVPGLS
FT                   DRPSTPYRSEGINPDLPVLKHIAESGAKLSELGAMHGLQRVLVRRDKQFMILNVTPDGE
FT                   AIIAGLQSDFPFDELKKSLPIDVTELQDTHAIKGLFVRNGHEFQVLYLTPDGQNVIPGV
FT                   MWDATGHNITRDQVSSIEGAIPRVEIKNDTMPAVAVSALDGKPSLSVVKETSFGTYGRS
FT                   GAPRLWIFVDPLCSFSIRAMDQLRSYATRGEIELAVVPVSIIDHEDGGKSTEHALSMLS
FT                   LPRETMVAAWRNDQLNNPVAAEARDRLTINMAAAEVIHLRGTPTLLWQKEDGSEGRLDG
FT                   LASDWDRVIASMRH"
FT                   /protein_id="YP_001831123.1"
FT   sig_peptide     157937..157993
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.677 at
FT                   residue 19"
FT                   /locus_tag="Bind_3850"
FT   misc_feature    158372..158923
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:185959"
FT                   /locus_tag="Bind_3850"
FT   gene            159003..159530
FT                   /db_xref="GeneID:6197967"
FT                   /locus_tag="Bind_3851"
FT   CDS_pept        159003..159530
FT                   /locus_tag="Bind_3851"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676977"
FT                   /db_xref="GeneID:6197967"
FT                   /translation="MAMSDHEPQQKETGLFGRGFKGLKQASLKAIQWKLIKDNAQFIHE
FT                   LGALLRRKKDHQSGLVIGEDRMLDVAATADLYQVPVEFIEDLIMKRRRQTKQAAYCAFG
FT                   FGWLAFLYWLYQSLTRSWSSGHVIETLEFAPFCLVFFLIAFRNALLNYQLRTGHVATAM
FT                   EYLRTEKVFWPA"
FT                   /protein_id="YP_001831124.1"
FT   gene            complement(159587..159898)
FT                   /db_xref="GeneID:6197966"
FT                   /locus_tag="Bind_3852"
FT   CDS_pept        complement(159587..159898)
FT                   /locus_tag="Bind_3852"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2608 hypothetical protein"
FT                   /db_xref="GI:182676978"
FT                   /db_xref="GeneID:6197966"
FT                   /translation="MRFFLSLILLCTLALSACGAPPNIRGASNYTIPLPQRVEHPYYDP
FT                   TAAYGESNATWRPPVINLNRTIVKPVEPATTAGRPDYEHAQWASGASGGPSNAPPGTF"
FT                   /protein_id="YP_001831125.1"
FT   sig_peptide     complement(159839..159898)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 20"
FT                   /locus_tag="Bind_3852"
FT   gene            complement(159946..160407)
FT                   /db_xref="GeneID:6197965"
FT                   /locus_tag="Bind_3853"
FT   CDS_pept        complement(159946..160407)
FT                   /locus_tag="Bind_3853"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676979"
FT                   /db_xref="GeneID:6197965"
FT                   /translation="MLEDDEEGGSSLFGNYSWYQMGRASAESDARTRQLLRARFSPPKP
FT                   QIDVDALIAQNNALRQNYAQLHQDYQKLYGLYEQDQRQKSALQKELKEAKEFGESALKG
FT                   YRDRGDDITDISNTLMYAVKYLCDKGYRVKDLPFKIPLWLYQMYENRNN"
FT                   /protein_id="YP_001831126.1"
FT   misc_feature    complement(<160000..>160257)
FT                   /note="exonuclease subunit SbcC; Provisional; Region:
FT                   PRK10246"
FT                   /db_xref="CDD:182330"
FT                   /locus_tag="Bind_3853"
FT   gene            complement(160410..162740)
FT                   /db_xref="GeneID:6197964"
FT                   /locus_tag="Bind_3854"
FT   CDS_pept        complement(160410..162740)
FT                   /locus_tag="Bind_3854"
FT                   /gene_family="HOG000057770" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2610 hypothetical membrane protein"
FT                   /db_xref="GI:182676980"
FT                   /db_xref="GeneID:6197964"
FT                   /translation="MRLLFTLATLFFACLALEPAFAQIANNGTALTWAVLDPGNDWAAQ
FT                   AINNIFPINQNGATTVIGQIMGQLTRFVMAIAMAFLCYHFIMNIHRVAETSRLMTDAMT
FT                   WMGVVRIGFAAIMMFPLASGFSNGQAMVVKTAMWGIGMAKAVYANAIQAIGPDALVIAQ
FT                   PMIPGTSTTVINLIQNEFCRALINQASGNPNLVPIPNPVVGEPVATLTYITWAYGLASG
FT                   NETGTPVCGTVTLQQSSGATNLAGVSVDMPAIQQQILQSVLNADIRSTVPMVVQNFWQT
FT                   KQASALAPLLQIFQTATADYTQQLTNTATQVTSQLRNALSDPTQARAGSIGLITNETQL
FT                   NSLGWTSAGAYYLEIARLNGQTMSLLNATPMVSPPSFEGLSKSLKNDLAPLVTAETQFL
FT                   SNLRSYVTTTDGLDAPTGNAQLFSGATPGGDGASAIEQVMRSIHLSDRVLSYFTEAMSP
FT                   TGNNWTDPFGSLMQLGHKLIVIALTALGAAGLLSSTTGTVASTAWNILTLNFAGAAASV
FT                   AGSALVQFFGTPIFLACLALLIPGLTIAFVLPMIPWVMWMAGVAGYLILVCEAVVAVPL
FT                   WMLAHMTLEGAGLHGRAIEGYGLLFNLLFRPVLMLFGLFLGYTIFAAMSWLVRMSFGIA
FT                   AGFVLANGWVVTNILGVCVLLSIYVTIHIVLALTSFRLITLIPHHLPRLVGFTATNRVD
FT                   MNQFSKEAALVGVGGALTTMREGLREGAFGAGEAVQKQLGYTRKLTGPTTSSPEQSSSA
FT                   SKHGMDSTLRAATDTQNSPNEEV"
FT                   /protein_id="YP_001831127.1"
FT   sig_peptide     complement(162672..162740)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT                   /locus_tag="Bind_3854"
FT   gene            complement(162804..164261)
FT                   /db_xref="GeneID:6197963"
FT                   /locus_tag="Bind_3855"
FT   CDS_pept        complement(162804..164261)
FT                   /locus_tag="Bind_3855"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2611 hypothetical protein"
FT                   /db_xref="GI:182676981"
FT                   /db_xref="GeneID:6197963"
FT                   /translation="MPDLNERDRSEPLRFASDRPDPVTKPETVKPEGKDAGAIKPDAET
FT                   PKSADTTAKSPDAHEPKKEDHDELRQLIMQLEIIRANRALPDKLGEAIKELRQDADTPA
FT                   KLDDPTVRTKLAYAVQDAEKVGAVLSMPQALRDQLRKSGTTLPNLRNEGMQALLKDTPN
FT                   IDDHNLVTKIRLEAANTTTLPDQHTQETNSKAATLENEARLAQRIPEAQQTQAAAATIN
FT                   SAERQAEKPATQANNQAAPPSRQDANQIFTDPEITGIKLRLPGAAAEILSNLGPERSKA
FT                   ENADAQRVSLFDRLSNYQANVLGPRNEEKAIQSTFEAGADANAALQEFSNGPGRAIMAK
FT                   IEQAAKSKPEGMAGVLSEMRSGGRYADLRGQFDQALLTEKNLAASYDKATSALANYADK
FT                   RAAIEPVIAKQPDAGALAAKLQQVDASVGEKAEVLPGRKEGENALEELAKKAGEAISKA
FT                   VEKIQGAIQRFTGNAEHSASASPRPSP"
FT                   /protein_id="YP_001831128.1"
FT   gene            complement(164279..165448)
FT                   /db_xref="GeneID:6197962"
FT                   /locus_tag="Bind_3856"
FT   CDS_pept        complement(164279..165448)
FT                   /locus_tag="Bind_3856"
FT                   /gene_family="HOG000057771" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2612 TraW"
FT                   /db_xref="GI:182676982"
FT                   /db_xref="GeneID:6197962"
FT                   /translation="MKRISPLASTAVGLVLGAMVFGAAPTSAQMPVVDWTTLPVISTIS
FT                   SVIKQVNSGISSLQDGIGSAVNGSVTELLLKGFTQNANYSKAQISAQQQIADASNTAMA
FT                   RFQRDVRNSQIRDQHTINPLICAGQDNGQTVIVGAGQSWKVARAIQDVNDNRGEANANT
FT                   PAFYGTAQAIASNNDYHSKFYCSQTEADAGLCQLSATPNADQRASSLFGTGTYNGQQGV
FT                   NDANAYAMTLIQPIVPAALRGSQLTSTMGEEARVRRREYNARVSLARNTLDYVMAAQTQ
FT                   SIPLSAEQQREMTDEGLPATQNGSWLQGLTLDVNRRYGSLNYAAQLMAMTPAALQREVA
FT                   QELALTNYLLLHNYRLGMMNASTNATQLAAEAERSLEPTPMPTPSIVAN"
FT                   /protein_id="YP_001831129.1"
FT   sig_peptide     complement(165362..165448)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.882 at
FT                   residue 29"
FT                   /locus_tag="Bind_3856"
FT   gene            complement(165457..166002)
FT                   /db_xref="GeneID:6197961"
FT                   /locus_tag="Bind_3857"
FT   CDS_pept        complement(165457..166002)
FT                   /locus_tag="Bind_3857"
FT                   /gene_family="HOG000057772" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2613 hypothetical protein"
FT                   /db_xref="GI:182676983"
FT                   /db_xref="GeneID:6197961"
FT                   /translation="MKRSLPMVLVCLAIPLPAFAQTVNTTTGTAGCAKLVQVSADTISQ
FT                   RIAADDANINAPKSVKTLTCLDNFFKGAGLDVITNFLNPTNLLQSIEGQICNAISSAWQ
FT                   NSLGQPQCGITLTGFNLGFGGLGNLGGGLSCPKLTFGGGGPPMGSISVSGNGNGQFRVN
FT                   GAGVAPAGYTVSQQNGLW"
FT                   /protein_id="YP_001831130.1"
FT   sig_peptide     complement(165940..166002)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT                   /locus_tag="Bind_3857"
FT   gene            complement(166002..166460)
FT                   /db_xref="GeneID:6197960"
FT                   /locus_tag="Bind_3858"
FT   CDS_pept        complement(166002..166460)
FT                   /locus_tag="Bind_3858"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676984"
FT                   /db_xref="GeneID:6197960"
FT                   /translation="MPDPSPPAPPCWLEPADGPIHLIDPLEEAANDPVLSEDFIRFASA
FT                   IDRARQSKPEALSEALQSQATRDQVQDFLQGLPIDRKVQLLALMTHPGLPHRRAVTAAL
FT                   LTSKDKGSSLSLSRALQADKRDKMMRRIYAPERVAFLKDVTKHMREDA"
FT                   /protein_id="YP_001831131.1"
FT   gene            complement(166527..166970)
FT                   /db_xref="GeneID:6197959"
FT                   /locus_tag="Bind_3859"
FT   CDS_pept        complement(166527..166970)
FT                   /locus_tag="Bind_3859"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676985"
FT                   /db_xref="GeneID:6197959"
FT                   /translation="MRALLSIVLLGSFALCAPAKAEFTVLPSASHAAEGIKKTQPKPAK
FT                   SLNKRKPQHSQQTGGNKNKTAILKPKSSLEAQAIGFGSQIPLSFALKQIVPPHMTIQFG
FT                   PGITPDVLVDWRGGREWKIVLEEAVQPLGIHVSVKGQALVLSL"
FT                   /protein_id="YP_001831132.1"
FT   sig_peptide     complement(166905..166970)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.956 at
FT                   residue 22"
FT                   /locus_tag="Bind_3859"
FT   gene            167133..167588
FT                   /db_xref="GeneID:6197958"
FT                   /locus_tag="Bind_3860"
FT   CDS_pept        167133..167588
FT                   /locus_tag="Bind_3860"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="XRE family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   rpa:RPA4787 anaerobic benzoate catabolism transcriptional
FT                   regulator"
FT                   /db_xref="GI:182676986"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:6197958"
FT                   /translation="MPRKPVNINNLDDETLKSLAIIGKKIKDMRVAKGLSQKALSGKSG
FT                   VSHQYILLIEIGTQNATIGILKRISDALEVPFYSILPDEWLTGGLDEYVLNLFEKQSSH
FT                   LKKDFADNSMTVSILDNMWKKFDEARTMIEEAQRALGDILERVKSGK"
FT                   /protein_id="YP_001831133.1"
FT   misc_feature    167199..167363
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bind_3860"
FT   misc_feature    order(167211..167213,167223..167225,167298..167300)
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bind_3860"
FT   misc_feature    order(167220..167222,167295..167297)
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bind_3860"
FT   misc_feature    order(167241..167246,167277..167279,167286..167288,
FT                   167298..167303)
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bind_3860"
FT   gene            167697..168671
FT                   /db_xref="GeneID:6197957"
FT                   /locus_tag="Bind_3861"
FT   CDS_pept        167697..168671
FT                   /locus_tag="Bind_3861"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676987"
FT                   /db_xref="GeneID:6197957"
FT                   /translation="MLLQPSLPGLDYLEQDETHASVLSFTAPPRASVLQSLDLILMGMV
FT                   GAGLGIEALCLYFDLTRIQLCERLLALDLEMPADKPIRRFAGKNPWSVEDIRHLIRWWS
FT                   DGIHVKSIAPSLARSENAIRAKARRIGLPRRDRRLLSYQDLPPLKPLPLDEPSSESLQS
FT                   DILPETHSNLTLTPQTKRFGVEIWKKEHDDDALLLYFGQINNAMAAQYLNDKWGTHYSA
FT                   AAVSSRWTRLGCKGRNRKAMAASFDPVTAEANFKASGFVKRQCHTLKRVFVERRGVYSY
FT                   NCPEAQKRVEKITIRKPRETVDHYRRGSVSLPVLKFLERNSSL"
FT                   /protein_id="YP_001831134.1"
FT   gene            168721..169350
FT                   /db_xref="GeneID:6197956"
FT                   /locus_tag="Bind_3862"
FT   CDS_pept        168721..169350
FT                   /locus_tag="Bind_3862"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: lpc:LPC_2894 IcmL (DotI)"
FT                   /db_xref="GI:182676988"
FT                   /db_xref="GeneID:6197956"
FT                   /translation="MQNQRAAVMRRLSDPDFQASLVNKSIMLVMGMFVMQAIFVIHDVY
FT                   VWMNPPQNKFFIVDGKGPPHLATPLSSPVRGDREMLAWTVDSILGVYNLNYHDYPVQLT
FT                   TAGRRFTQKGWISWADSYKKSGNFDTMKQAMLLCDAQAQRAAIIRESTMLQDALAYRIE
FT                   VPIVQTCRNSQQTSSQNMLLTALVVRTNSEDYPDGLAIEQLVARPM"
FT                   /protein_id="YP_001831135.1"
FT   misc_feature    168925..169218
FT                   /note="Macrophage killing protein with similarity to
FT                   conjugation protein; Region: IcmL; pfam11393"
FT                   /db_xref="CDD:151833"
FT                   /locus_tag="Bind_3862"
FT   gene            169359..170321
FT                   /db_xref="GeneID:6197955"
FT                   /locus_tag="Bind_3863"
FT   CDS_pept        169359..170321
FT                   /locus_tag="Bind_3863"
FT                   /gene_family="HOG000057773" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DotH"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2617 DotH"
FT                   /db_xref="GI:182676989"
FT                   /db_xref="GeneID:6197955"
FT                   /translation="MPNQFNLWCCASALILLSGSAFAQVVANTGNNSLSPNDVEVGPAT
FT                   DLPANALPLTPEMIRELGRRYREIKREEERATTQIATPVSRRINVAFIPGQATNIIQTV
FT                   KGYPSAISFFDSTGQPWPIEWNSNSNPSSIAGGSNCNATTNTGGPAVAAVGFHVCTPTK
FT                   GSNVLEVTPMSLEPRGGLVVTLEGAPKPLSFMLVGGGGRYDSDVSVHVADRGPHAKVEI
FT                   TRRTPAPDTGSGFLTAMLDGVPPAEATPLVVSGVSPEDLRAWRLGDKVFLRTRMTLISP
FT                   EWTASEAGEGGLTIYSVPATPVVLLSGHGRTVSAALQEQ"
FT                   /protein_id="YP_001831136.1"
FT   sig_peptide     169359..169430
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 24"
FT                   /locus_tag="Bind_3863"
FT   misc_feature    169515..170300
FT                   /note="Protein of unknown function (DUF3625); Region:
FT                   DUF3625; pfam12293"
FT                   /db_xref="CDD:152728"
FT                   /locus_tag="Bind_3863"
FT   gene            170323..171624
FT                   /db_xref="GeneID:6197954"
FT                   /locus_tag="Bind_3864"
FT   CDS_pept        170323..171624
FT                   /locus_tag="Bind_3864"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2618 DotG"
FT                   /db_xref="GI:182676990"
FT                   /db_xref="GeneID:6197954"
FT                   /translation="MVDLSASLSKFLPRKPAFLNAGGKGGPRRLLVIASTGVSMMALVV
FT                   VLSLQSQKDSLDSSVTKPPAINPNPGGLQSDPAQEKLRTVTQREQAKKAEEIGYSFTPV
FT                   MAGSQRTKPLITPEFPEVQEPPKPLVGTPVIAPVTPPKRVVSLNPAVESDAPSQAMIHK
FT                   VAQRSQEEDKAYQMAIAQMLSSWEGRPPRTDIILPPEDKIISKSGDEPRASQAEPASGL
FT                   AARSKANRSPAILDQRARETVLIPAGRMIYAHTVTAADSDSNGPIILQADSGPLAGDRM
FT                   IGSFSKSKSTRLIVLVQKIEHNGQELTADGLVVAPDTMETTVASDVDQHYMERVIIPGA
FT                   AAFVEGVGQAIAMSNTTSQVSPLGGVTAFTKLNFQQQLGVGAGAVASRLGSILTQQMPT
FT                   GPTVQLGANLPVGVMFISPVKMKTAADQASSFAQ"
FT                   /protein_id="YP_001831137.1"
FT   misc_feature    171052..171567
FT                   /note="Bacterial conjugation TrbI-like protein; Region:
FT                   TrbI; cl04242"
FT                   /db_xref="CDD:186623"
FT                   /locus_tag="Bind_3864"
FT   gene            171680..173110
FT                   /db_xref="GeneID:6197953"
FT                   /locus_tag="Bind_3865"
FT   CDS_pept        171680..173110
FT                   /locus_tag="Bind_3865"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2619 hypothetical protein"
FT                   /db_xref="GI:182676991"
FT                   /db_xref="GeneID:6197953"
FT                   /translation="MTAQTMALIEDDDDDDHGSSVAQSEGSHALVAGRSASFWRKPLPQ
FT                   WLSGKKARREGSGQADTQAELQAPETAPETEADAPIGLPGEGQAILEPPQGAEGAQTPG
FT                   KSQWKPSKPLLIGVSLTALLVAANIGIMSYPQSSPSLPVAGPVAERQAGPLAPLAKLAT
FT                   VQPHQPAEDPTAVSVPAQSPMDELLSFHPVDPITGKASGGEEHKAAQPILAKLEVAPQQ
FT                   SKTTAFPMDYFGTQAFASLNGQDQTSSKPAETVTEPMMQAATQAKIEETKSSDIPRVDV
FT                   KEAKPSSQGTVPQTLVTSAVSTDPHDAENRALAMVTEYATIVGELRTEVAEMKQKLAHA
FT                   SQSNEARISDLERRVTFTEARRALDAAHDAPRLVAMPVPPGAQKAGGKPSANTGMIKAS
FT                   FDPSSREPTPSIEGRPRYRVQAASPNLAMLTALDRSGEADGQIQVAIGDVIPNYGRVKQ
FT                   IAQKGTSWVIETDQGTIE"
FT                   /protein_id="YP_001831138.1"
FT   gene            173120..173656
FT                   /db_xref="GeneID:6197952"
FT                   /locus_tag="Bind_3866"
FT   CDS_pept        173120..173656
FT                   /locus_tag="Bind_3866"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676992"
FT                   /db_xref="GeneID:6197952"
FT                   /translation="MQGLVNFAAAVGQGLAVFLPTFCYLTAIGLFLFAGWGFWRQAQPD
FT                   NPYRGKPWIPIFSLVLCGVFASFDRILTMANVSMGTNLQVSLSNNLTSYAPPVDGNVLG
FT                   TTPGTTLLNVVTLFQSFFQAFGAMACFFAVLTWWSIVTGRTNRSTVGTGVQFVFGVLLI
FT                   NVMTVATWLVTIFQT"
FT                   /protein_id="YP_001831139.1"
FT   gene            173677..173838
FT                   /db_xref="GeneID:6197951"
FT                   /locus_tag="Bind_3867"
FT   CDS_pept        173677..173838
FT                   /locus_tag="Bind_3867"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676993"
FT                   /db_xref="GeneID:6197951"
FT                   /translation="MNGLYIGALFFLGLTAYSLFKGFVRGPKRYYILAGSIFLFVSSFY
FT                   VAVDLLHL"
FT                   /protein_id="YP_001831140.1"
FT   gene            174056..174514
FT                   /db_xref="GeneID:6197950"
FT                   /locus_tag="Bind_3868"
FT   CDS_pept        174056..174514
FT                   /locus_tag="Bind_3868"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mbb:BCG_0318c PE-PGRS family protein"
FT                   /db_xref="GI:182676994"
FT                   /db_xref="GeneID:6197950"
FT                   /translation="MQLLGVKKKAADKTEADTEKKSLVERILGVGAVGVSLGALMTGQA
FT                   FAQGASPAGGIGAQLNSLTSEAINSGGQAGQMAMYLAALLCFVAGVWALWQAQQPQNRE
FT                   GGMRAAGIAGIILCGLFATGGTWINKAAMSTGGKTATVSATPQTVSFQ"
FT                   /protein_id="YP_001831141.1"
FT   sig_peptide     174056..174199
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.858) with cleavage site probability 0.855 at
FT                   residue 48"
FT                   /locus_tag="Bind_3868"
FT   gene            174532..175179
FT                   /db_xref="GeneID:6197949"
FT                   /locus_tag="Bind_3869"
FT   CDS_pept        174532..175179
FT                   /locus_tag="Bind_3869"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2621 hypothetical protein"
FT                   /db_xref="GI:182676995"
FT                   /db_xref="GeneID:6197949"
FT                   /translation="MPLLPLVPNILEGSAFLVPPTHERQTTLFSCQFCGFDAAGWQVPF
FT                   QDPETGKAGSSCVLCSLVLRLDRPRIDEELALIWLPEMSQAAVNAVARSLHGLFFAHGE
FT                   APSPALRPHGETARMRAAWFFWQSLLQRQAIAKERFGSDRPSDIGQVLASVAPLIFNRR
FT                   SKLLSGLRLLPLGHVYQGGQDHYPRLLASYLKTQKQAGQGIRGTVETVPSAS"
FT                   /protein_id="YP_001831142.1"
FT   gene            175191..178247
FT                   /db_xref="GeneID:6197948"
FT                   /locus_tag="Bind_3870"
FT   CDS_pept        175191..178247
FT                   /locus_tag="Bind_3870"
FT                   /gene_family="HOG000263341" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DotO"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2622 DotO"
FT                   /db_xref="GI:182676996"
FT                   /db_xref="GeneID:6197948"
FT                   /translation="MNFIAQWLASLSLMLKQPLGAYCDVETAHGDALVTRYGDYLSFVR
FT                   IDGLRRMCTKAEYADMAKAMRLDLSGTLEERGHAIQGFYISDPDLSEREINRVNMTACR
FT                   TVAKEVGLDLDDILDERMRIWPRVMRWEAAYYVLWTRRGILTKEEKKILKEEMAELAKG
FT                   CPAIGESQKYFLRSEVTAAHHAGFVARVVNSFKSLDIHAEELTAHDALKVARETLYRET
FT                   SGSPWKAILPGQKVMPRLPEDDEKHPTAEGLLWPSIRSQMLTFDAITQGGQQVALGTNT
FT                   YAPIDMVMGPEDPRPFLELASYLGQDRIPWRASFLLEAAGRNGMAFKEIGATFLGMFPQ
FT                   NGDLRRAFAALRQAREEDNHGAVKFRASFATWAPGDDIRKLRRRASTLSQRLEGWGNCK
FT                   TGTMAGDPLDAAMSSVPGMAVASTAPPSLALLGDALLMQPWSRTASPWEAGSVLFQLPH
FT                   GGLWPYDPAGGSKRPSVVDIFVAPPRSGKSVLANTINLGLCLSSAVLGSRGAKLPMIGK
FT                   VDIGPSAQGFVRLIQEALGPARRHEAIYTLMQLTPGYEFNVFDLQLGCEYPLTLERAFL
FT                   QNFLVLLTLPPDRNEPHEGVPQLINVLIDEVYRLHTDIQGGYPKIYQAGVEKEVDKAIA
FT                   KHGIVLHEHEPHWRDVVNELFKCGEYRLAEVAQRHAVPVLEDLIRAVQSEIVKDQFNAL
FT                   QLHTTAEKVTELFSRYLQDAIRMYPILNKPTKLDFGPARIIVLDLEEVAPQGSAVADRQ
FT                   TSIMYLLARYILARNFFLKPEYLVQVPNAYRDYHHDRFREAYESIKRLDYDEWHRTSGS
FT                   PQIRAQAARDIREGGKHNVQLAFTSQQIKDMGDDIISQSTGRWILRAGDEEEAKIIIER
FT                   FHLTEASARVLRSSLNGPGPNGAPVLTILEAGAYRYEQLLVNRLGPVELWAFSTTPGDT
FT                   SLRNRLYSRLGFSEALRRLSQIFPHGSALKEIERRKEERLRNGERDESVQAGVVDELVE
FT                   ELMDGLGIGLKLRDQVEAQNEEKSLASVA"
FT                   /protein_id="YP_001831143.1"
FT   misc_feature    <177354..178043
FT                   /note="type-IV secretion system protein TraC; Region:
FT                   TraC-F-type; TIGR02746"
FT                   /db_xref="CDD:162997"
FT                   /locus_tag="Bind_3870"
FT   gene            178511..178993
FT                   /db_xref="GeneID:6197947"
FT                   /locus_tag="Bind_3871"
FT   CDS_pept        178511..178993
FT                   /locus_tag="Bind_3871"
FT                   /gene_family="HOG000057774" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eci:UTI89_P001 hypothetical protein"
FT                   /db_xref="GI:182676997"
FT                   /db_xref="GeneID:6197947"
FT                   /translation="MAPQTLIFILEGLAIGLACLFLLSKFGKPAFPYQAKTLLTAWEIN
FT                   ALKELVRTLPPSLHPCPQVRLADLVMIKQGLSGRHRFTALNRVAAKSVDFVILEHHTGR
FT                   IVLVIELDDKTHARRDRRVRDRFVDDVLNRCAIPLLRVKPGESIASRVLSHGALLP"
FT                   /protein_id="YP_001831144.1"
FT   misc_feature    178613..178942
FT                   /note="Protein of unknown function (DUF2726); Region:
FT                   DUF2726; pfam10881"
FT                   /db_xref="CDD:151330"
FT                   /locus_tag="Bind_3871"
FT   gene            179025..179573
FT                   /db_xref="GeneID:6197946"
FT                   /locus_tag="Bind_3872"
FT   CDS_pept        179025..179573
FT                   /locus_tag="Bind_3872"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182676998"
FT                   /db_xref="GeneID:6197946"
FT                   /translation="MSLPKVLCIAALPVAALGFIGFKVNEAWTKQEITEQVRSFYDHTC
FT                   GLLAPITPQENETISVEQYDALVDAGMMTRSPEAVYGLTAQGQAAFQLRDKWPMGKAGL
FT                   CAYHFEDATVEDVSLTEIISNHFLRHVTFKFHTRYEDWAKTPSVQKAYRSELGLSRESL
FT                   LTAPMVLTKSGWIFVEPLI"
FT                   /protein_id="YP_001831145.1"
FT   sig_peptide     179025..179105
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.904) with cleavage site probability 0.716 at
FT                   residue 27"
FT                   /locus_tag="Bind_3872"
FT   gene            complement(179592..179936)
FT                   /db_xref="GeneID:6197945"
FT                   /locus_tag="Bind_3873"
FT   CDS_pept        complement(179592..179936)
FT                   /locus_tag="Bind_3873"
FT                   /gene_family="HOG000043828" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone family protein DNA-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: pla:Plav_0506 histone family protein DNA-binding
FT                   protein"
FT                   /db_xref="GI:182676999"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="GeneID:6197945"
FT                   /translation="MAISKSKPATEKKAASSSKTTEIPTITLKQIGADLAILHDLPKKT
FT                   VESLFDDMVELVGKHLKKGSKIRISGLGIFQVKKRASRQGRNPATGEAMKIKASKTVGF
FT                   KIARDLKESL"
FT                   /protein_id="YP_001831146.1"
FT   misc_feature    complement(179598..179858)
FT                   /note="Integration host factor (IHF) and HU are small
FT                   heterodimeric members of the DNABII protein family that
FT                   bind and bend DNA, functioning as architectural factors in
FT                   many cellular processes including transcription,
FT                   site-specific recombination, and higher...; Region: HU_IHF;
FT                   cd00591"
FT                   /db_xref="CDD:29683"
FT                   /locus_tag="Bind_3873"
FT   misc_feature    complement(order(179598..179600,179619..179621,
FT                   179625..179627,179637..179642,179706..179708,
FT                   179721..179726,179733..179747,179757..179762,
FT                   179769..179774,179781..179783,179823..179825,
FT                   179835..179837,179844..179846,179853..179858))
FT                   /note="IHF dimer interface; other site"
FT                   /db_xref="CDD:29683"
FT                   /locus_tag="Bind_3873"
FT   misc_feature    complement(order(179613..179615,179622..179624,
FT                   179628..179630,179640..179642,179670..179681,
FT                   179688..179690,179694..179699,179703..179705,
FT                   179715..179717,179724..179729,179733..179735,
FT                   179739..179741,179784..179786,179850..179858))
FT                   /note="IHF - DNA interface; other site"
FT                   /db_xref="CDD:29683"
FT                   /locus_tag="Bind_3873"
FT   gene            180120..180524
FT                   /db_xref="GeneID:6197944"
FT                   /locus_tag="Bind_3874"
FT   CDS_pept        180120..180524
FT                   /locus_tag="Bind_3874"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:182677000"
FT                   /db_xref="GeneID:6197944"
FT                   /translation="MNKPFFASKQVQSLLDEVNNALGHPVRADHKRLTANIPFGALHWT
FT                   RADLFPDKEWGKAHFTIETGCGIACIFVDIVQSECTLPIKCQTESDWDGEYPTTKSEIE
FT                   ISLTLNDIKCLVAILLYSYAPLSVSITTSE"
FT                   /protein_id="YP_001831147.1"
FT   gene            complement(180485..181450)
FT                   /db_xref="GeneID:6197943"
FT                   /locus_tag="Bind_3875"
FT   CDS_pept        complement(180485..181450)
FT                   /locus_tag="Bind_3875"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: psb:Psyr_1149 hypothetical protein"
FT                   /db_xref="GI:182677001"
FT                   /db_xref="GeneID:6197943"
FT                   /translation="MSIPKAFCTDVNRIIDIVEAREIFFSQTKHPRKRLDFRCPDNECR
FT                   QAHNPEVLGINYDKNPQEDDFVQRSHFRLKKGTTHLPTCPWAEISQALDELEREIGNKP
FT                   YLSHLKKSEIINVFNPLSNDECDTKFTMDIDAGFLERIKLISDRRERINELKGYLKNAL
FT                   NSTSRLHEVVHCFKFMTPEEQKAVSLSIPPYGEKSYRSWFRSSMYCRENEQPLIYYGAA
FT                   NIMEYRTGYSFKFWNKSVQSDQSNCEVFTFVKRERISKLRGAKAILDVLERGIGMQMRH
FT                   RYPVDIFVFGKAVLTIEKHRLDIHIHSLHSLVVMLTERGA"
FT                   /protein_id="YP_001831148.1"
SQ   Sequence 181736 BP; 39271 A; 49705 C; 52423 G; 40337 T; 0 other;
     AGCGCCCATT AGCCTGATGT CTGAACGACA ATCAGGGGGC TTTGAATGCG ACAGACTTTC        60
     TCCGTTTCTT CCCGCGTGGC GCCGCTTATC CTAACCCTGG GCCTTGGGGC CTGCGCCACG       120
     CCGATCCCGA CTTATGTCGA TGTGCCGGGC ATGGCCAATC CCGAACTCGC GCTGCGCGAG       180
     AGTTTCGCCA GCGTCGATGC GGAGACTGCC AAACTCGGAA GCCTTGATCT CAAGGATCCG       240
     CTACCTCCCT CGCCCGTCTC AAAGTCTGCC GAGACCCCGG CAAGACCGGC CAAAAGCCTC       300
     TCTCCACTGC AGCGCACGGG CGTTGTCCCT GGCGAATTGC AACGTGTCGT CCAATTTCAG       360
     TTCAATGGCT CGCTCGACGA TGGCGTGACC CAGCTCGGCA AGATCATCGG CTATGATGTC       420
     GCGATCCAAG CGCCCCCCAA TGCCGAGCCA CAACCGATCG TCGTCGAGGC GGTCGAGGCG       480
     CCTGTCGTCG ATTATCTCCG GTCCATCGGC AAGGCGGTTG GTGATCGCGC CACGGTTCAG       540
     ATCGATCCGC AGCACCATCA GATCCAGGTG ATCCACCATG TCTGAGCGCC GCGCGCCCCA       600
     TGGCCGCCGC TTGGGCCTCA CGCTCGTGGC CGGCCTCACC TTCCTCCCGC CTGCCCATGC       660
     CGAGAACAAT GTGACGATCC TGCAGATCCC GCCAGAGCCC AGCTTGCGGG AGATCGAGCA       720
     GGCAGCGCGG GAAACCGGCA ATCCTTTGTC GAAGCCGGTT ACGGGCGCCA AGCAGATCCC       780
     GGCTATTACA GGTGGCGAGC GTCCACCGTC TCTTGAGGCT CTGCAAGCGG CTTTGCCTGG       840
     CCCTCAGCCT GGCGACGGGC TTGAGCCCGG ACGCGGCGAC ATCCTCTATC AGGCGGCTTT       900
     GACCTTCGGG GCTCAGGGCG GGCTCGCCGC GCGGGCTTTC GGTATCAACG AAATGCTGCG       960
     CCGGTACGAG CCGACACTCG ATAGCGTCTT CGATTTCAGG ACCGTGGTGG TGCGGGTTGG      1020
     TCCGGGCCGG ACCCTGATGC GACCACCGAT CGTGACGGCG GCGCAAATGG CCTTCGCTTT      1080
     GGGAGAAGGC GCGCAGGTCG CCCGCGAGAC GGCCTGTGTC TATCAGATCA CGCGCCGCGC      1140
     TCAGCTCGCC TCGGCACCGC CGAATTGGCG CACCTATCTC GTGCGCTCCT GGGCCTCACC      1200
     GTCAAAACCG TCCGATGCGG TCCTGCCAAG GACCGAGCAG GAGGTGAACT GGTGGAAGAA      1260
     ATGGGTGGCC GAAGGCTGGG CGCAGGGCGA GCGGCAGGGG GTCGAGATTT TCCTCGCCGA      1320
     TCTCTCCCGC CTGCAGCGCG ATTACATCGG CATGGTTCGT TACCGCGTCC TTCTTCGCGC      1380
     GGGCCTCGTG GAAAATCCCC GTGTCGCCTT CGAGGATAGC CTCGTCAATG GCGGCCATGA      1440
     AGAGATGCGG GCAGGCGATC GCGTGATCCG CATCACCGAT CAACCCGGCC TGCGGGCAGA      1500
     CCGCAAATCC TGGCCGAAGA ACACGAGGGA TTGCCCGCAA TGAACGCGCC GCTTTCGACG      1560
     GTCTGGCAGG GACGGGGGGC TGACCCCTGG GTGCGCGATC CACGCAAAAG CGCGCCTGGT      1620
     CTCGATCATC TTCTGACCTG GGCCTATCGG CAGGGGGCTT CGCGCATCGC CTTTTTGAGC      1680
     GGTCATCCCG TCTGGGTGCG TATTCATGGC CTCAATCAAC CGGTTGAGCC CGATCCCATT      1740
     CCTGAAAGCG ATCTCGCTCT CATCACCAAC CATATCTATG GCGCCGATGG TACGGCGCGG      1800
     TTGAAGAAAG GCCAGGACTT CGACCTCACT TACGAAGTCC TGCTCGATCG CGGCACCCGC      1860
     CTGCGTTTTC GCATCAATGC GACGGCCACG CGGACAAGCC GCCGCGACGG CGTGAATATC      1920
     ATCCTGCGGC CGATCCCTGA CAAGCCGCCG ACGCTGGAAC AGCAAAGGGT CGAGCAAGGC      1980
     ATCCTGGAGT CCTTTCGGCC GCATGAGGGC ATGGTGATCG TCTCGGGGGC GACGGGCTCG      2040
     GGCAAATCGA CGCTGATCGC CGGCATGACG ATGGCCAAGC TGAATGATCC CAATGGCCAT      2100
     TACAACATCA TTGAAGGCGC GGCTCCCATC GAATTCATGT TCGATCGGAT GAGGAGCGAT      2160
     AGTTCTACGA TCGTTCAGAG CGAGATCCCG ATCGATCTGC CGACTTTCGA AGCCTTTATT      2220
     CGCGGCTGTA TGCGGCGTGA GCCCACTGAC ATCATTGTGG GTGAGTGCCG TGACAGTGTC      2280
     ACGATGGCGG CGGCGATCCA GGCGGCGATC TCGGGCCATA CTCTGACGAC GACGATCCAT      2340
     GCCAATGACG TCGCTTTGAC CATGCAGCGG ATCGCAAGCC TCTGTCCGCC CGATGAGCGG      2400
     GACAATCTCA TCAGCGCGGT GGCGCAATCG CTGCGCCTTG TCATCAATCA GAAACTGATC      2460
     CGTTCCAGCG ATGGGAAGCG CATCGCTCTG CGCGAGTTTC TGGTCTTCAA CCGCGCTCTG      2520
     CGAACCACTT TCCTCGAAAC CGATCCGAAA TTGTGGCCCG CCCTCACCCG GCAGGCCATT      2580
     GCGACGGAAG GACAATCTTA TGAGCAGGCG ATCAACCGCC TGCTCGAAGC CGGGCTGATC      2640
     TCGGAAGAGA CAGCTGCCCA TGAACGCAAG GAGATTGGAT AATGTGGCGG AATACGGCGC      2700
     GGCCCGTGAT GGTCGTGTTT CTCGATGCGC GAGCCTGTTT CCCGGTTCTC GCATTCTTCA      2760
     TGTACTGGAG TTGGACGACC GCCAAGATCG CCATTTTCGG CACGCTCTTC TTCGGCATGA      2820
     TCTCCTGGCT CGGCCTGACA CTCCCGTCGT TTGTCCGGCT TTTGCGGCGC TGGATCAATG      2880
     GGAGCCTTCG GCCAGCCATT CCCGCTTGGA AGCGCAGGAG GTTCGCATGA ACGAGGAGCT      2940
     GAGCCCGGTT CTCGTCGGCC GTGGTGTCAC GGCTTTATTC AAACTGACAC CGCGTCCGTT      3000
     GCGCCTCCAT GATCCTGTTT ATGGGACCGT GAGGGACATT CCATCAGAGG CAATCGGGGA      3060
     AGTCGACGGC TTGTTGCCGT TGTTCCTGGC GGCGGCCGAA GCGATTTGGT TCGAGGCTTT      3120
     CGGGCATGGC TTCGCGCTGA AACTCTGCAT CGATCATCAA TCGCTGCTTG GCTATCGGGT      3180
     GGTCAGCCTC GGTTGTGTCG GCTTCGTCGG CGTCATGCTT CACCTGATGG AGGCGATCTT      3240
     TCAAATCGCC CGACCCGACA TGATCCTGCT CAACGATTTC AGTGTGGTCT GGCAGAGCGC      3300
     CAAAATCCGG CTTGGTGTTG CCTCTGACAC TGACGCGCTG CTCTCGATCG CATAGGAGGG      3360
     CGAATGTTTT TCAAACCCGG TCTCTTCGGT GTGGCCTTTG CGGTCTTAAG TGCCTCTATC      3420
     ACTCACGCCG ATCCGCTCAT GAGCGAGGGC CAGAAAGTGC TGGCCTGTAT CGAGGCCTCG      3480
     GCCGAGATCC ATCATTTGCC GTCTGGTCTG CTCCTGACTC TCTTGCGGGT CGAAGCCGGG      3540
     GAGCTCGGCA AAGTCTCACA GAACAAGAAC AGGACGGTCG ATATCGGGCC GATGCAGATC      3600
     AATGATAGCT GGGTGCATAA GATCGCCCGG CATTGGGGAG CCTCCGATGC CGAGACTTAC      3660
     CGCGCCTTGC GGGACAATTT CTGCGCCAAT GTGGCGGGCG GCGGCTGGAT CCTGCGCCAG      3720
     ACGCTTGATG AGGCGAAGGG CGATATTTGG GAAGGCGTGG CGCTCTATCA CTCGCATACA      3780
     CCTGTCCATA AAGTCCGCTA TCTTCATCAG GTCCTGCATC ATCTCCATGC GCTGCAGAAG      3840
     GAAGCACAAG TTTCCTCTCG GAATTCAGGG AGCTGATGAT GGCGGGAGGC AATGGCGCTC      3900
     GCGCCGATTA TACGGTGTTC AGCACGATCG TGATCGTGCT GGGCCTTGGT CTTGGCGGCT      3960
     GGATGCTCTG GCAGAGCCAG CATGGCGAGA TCAGCGCGGC ACTGATGCAA TTTTATCATT      4020
     GGCAGATCCA GCACCTGCAG GGGTTTACCC ATCGCTTCGA TTTGGCCGAT CGCCAAATGC      4080
     TGGCCGCCAA TCCCGATCGG GTCGAGATCG GTACGCTGAT CCGAATGGCG CGGGCCTTGG      4140
     GACAATTCTT TCTCTATCCG GCCGTTGGCC TCGTGCTGTG GCTTGCCGTC GTGTGTTTCA      4200
     TCTATGCAGC GTCATCTCGC TATTGCCGGG CTCTCGACCT CGAGGGGCTG ATGCGTGAGC      4260
     AGGCCCAGAG CCATCCCGGG ATCACACCGT TCATAACCCG GTCGTTGCGT CTCCTGCCAC      4320
     TCGACAAGGC GTTTGTCCGG TCCCTCGATC CTGCCTTGAA CGTGCGGGAA TGGGTTGAGC      4380
     GGCATGCGCT GACAAGCGAT GGCACGTTTG ATAGGGCAGC GGCGCGCTGT GAGCTTATTC      4440
     GGCAGCTCGG CGATCCGTGG CAAGGCCCAG ACAAGGCGAA TCCAACGGTT CGCTGCATGC      4500
     TGGCTGTGTT CATGCTGCAT GCGGCGGGCA AGCGGAAAGA GGTGGCGGAA TTCCTGGGTC      4560
     AGATGGCCGA GGATCTGTCC GATGGAAAAG GCGAGGGAGC GGCCGGCCCA GACATGCCCC      4620
     TTCACTTTTC GGCGCCTGTG GTCCAGCGTG CCGATTATTG GCTCAAAGAC CGTGACTGTC      4680
     TGATCGCTCT TCTTGGCCCC CTCTCTCAGC CCAAGCACGG CTATACGGCG ACGATGCTGA      4740
     TGAGTGCCTT GACACAGGCA CGCCTGGTCT CGGGCGTCCT GGCGCCGGCG CAGTTCAATT      4800
     TCCTCAAATT GGTCGATCGC AAACTTTGGT TCGCACTCCA TTCGCTCGGT TTTCCGACGA      4860
     GCGGCAAAAG CCTGGAAACG CATCCCAACC CGCGCGTCGA GGCGATCGGC GCGCGCGATC      4920
     ATTGGTCAGC CGAACGGGTT TTTGGCGCTC CCCTTCGTCA TCCTTCCGTT GATCAAGCCG      4980
     TCGAGGCCAT CGCCGAGGCC TTTACCAGAC TCTCTTACGA GTAATCAGGA AAGCATCCAT      5040
     GTCTCAGATT GTTTTGTATT CAGGATTCGA TCAAGTCGAG GCTCAACCGA TTTACCTGCA      5100
     TTTTGACGAC GACTTGAAGG AATGTCGGTT GCGGATCGTT CCCTCATCAG GGACTGGCCT      5160
     TCACGTCCAC ATCGAACGGG ATGAGACCAG GAGATTTGGG CTTTTTCGAA AGAAAGTCCC      5220
     GAACGAAGCG GCAAGTGTTG GTGAAAGCCG CAGGTTTGTG CGGGATCCAA CACTCGTGGC      5280
     CGTGTTGATC ACCGTAGCTG GTATGAGCTT CAGTTGGATC GTGATGCATG TCGCGAAGAC      5340
     GATTCTTGAG AAACCCGATA TTGAACTCGT CGCCAAGGCA CCGGCCGCCA ACCCCGTTCA      5400
     AGCGGTTCCC GCGAACCCTG CCTATCGGAT ATGGGAAAAT ACTAGGGTCG GGACTTCTCA      5460
     ACCCGACCCG GAACTGAAGG TCGTTACGGA CAATCTCCGC CATGCGCCGA TCGTGACGCC      5520
     GGCCCCTGGC AGCGATCCGA ATTCCCCATC GGGACCGACC GCGTTTGGCC TCGAATAGGG      5580
     GCAAAGCATG CAACGGCTCT CCTGCTGCAT CCCATTCTGT CGGGCAACGC GCGGCGATCG      5640
     AAAGAATGAT CCCTTGCGAC CGGGCCTCGA GTGGATCTGC TCGCGCCATT GGCGTGATGT      5700
     TCCCGTAGTT CTCAAGGCAG AGAAGAGCCA TTGGCAGCGG CTGTCGCGCC CCGCCAAAGC      5760
     CAAAGGGCTT GAGACGCCGC GCATCCATGC GCGCGCCTTT GCTGCCTGGG AGGCCTGCAA      5820
     GGCCAGTGCG ATCGAGGCCG CTATGGGTCT TTGAGCCTTC TCAAATTCAA AAGGGAGAAT      5880
     GATCTATGAT CATGCGCGAG ATCGCTGGCC CGCAGGGGCG TTTCGAACGA ACGGGCGCGC      5940
     AAAACCTGCG CGATACCCGC TCGATCACGC AGCGTTTCGC ATCGGCACTG GTTACGAACT      6000
     TCTCGGCCGT CATGCTCACG GTCGGTGCAG GAGCCATGGT GATCGAGCCC GCGAGTGTTG      6060
     AGCTGATCGC TCCGGCCAGC CTGCTGTATG CCGGCATCGT CCTCACGCGG CGCGTCAAGC      6120
     TGCCAATGCG CCTCCCCAAG AGCGCCAGGA TCAAGGACTG GAACTATCCC GATCCATCCT      6180
     CCCGCAAGCC CCGCATGGCG GCCGGCACGA TCTATCTCGG CCGCGACATC GAAACCAATC      6240
     ATGAATTGTG GCTCACGCCG GAGGATGGGC GCCAGCATGC GACCATTCCT GGGACGACGG      6300
     GTGCGGGTAA GACCACGGCG ATCGTCTCCT TCCTGACCAA TGCTCTGACG CAGGGCTCGG      6360
     GCTTCGTGCT CGTGGACGGC AAGGCCGACA ACAAGCTCTA TGGTGAGATC CTAGCCCTGG      6420
     CACGCCGCTT CGGCCGCGAG GATGATGTCC TTGCCCTGAA TTTCCTGGTG GCGAGCGGTG      6480
     AGAAACAGTC GAACACGTTC AATCCTTTTG CGACAGGCAA CGCGGACGCC ATCCGCGAAT      6540
     TGCTGGCGAG CCAGCTCGGC GAACAGAATG CGCAGGATTC CAATGGCGTG TTCCGCGCCC      6600
     GCGCGGTGGC CTTGATTGGC ACGATCGCGC CCGTGCTCAC CTGGATGCGC GATCATCGCG      6660
     GCGTGCCGAT CAGCATCGAG ACGATCCGCT TTTGCCTTGA ATTACGCTGG ATCTGGACAC      6720
     TCGCCACCCA TCGCCTGTTC ATGGTCCGCG ATCCCTCAAA CGGCAAGATC ATCGAATACG      6780
     ACGTGTCGAA AGACATGCCG GAAGAAATCA TCTATCCGAT GCAGGCTTAT CTCGGCGAAC      6840
     TGCCAGGCTA TGATTCCAGC GTGCCCTGGA ACCAGCAGAA GGACAACAAG CCGTCCGAGC      6900
     AGCATGGCTA TGCGCTCATG TATTTTACGG CGACCTTCAC TCAGCTCGCT GTCAGCCTCG      6960
     GCCACATTTT CAAGGTGCTC AATGGTGACA TCGACATCCG CGATGTCGTG CTCAATCGGC      7020
     GTATTCTGGT GGTGTCGCTG CCAGCCCTCG AGAACTCCGA CGATACGCTG GCGGCGCTTG      7080
     GCAAGATCGT CGTCGCCTCC TTGCGCGGGA TGATGGCGCA GATCCTCGGT GCCAAGCTCG      7140
     AGGGCGATTA TGCGCAGATC GTCGAGAACA AGCCGGGCAT GGGTGTCGCG CCCTTCATGG      7200
     TGGTCCTCGA TGAGCTGGCC TATTATGCGA CGGGCGGTCT CGACCGCATG CTGGCCATGG      7260
     GCCGTGGCCT CAATATCATG TTCTGGTTGG CGTTTCAGGA AGTCTCCGGC ATTTGGGCGC      7320
     GGATCGGGGA GAAGACGGCC TCTCTACTCG GCAACGCCAA TCTGACCGTG GCGATGCGCC      7380
     AGCAGGACGC GCAACGCACC CGCGAATGGC TCGAACAGAC GGCTGGCCAA ACCTATGTGA      7440
     CCCAGGCCGG TGGCTATCAG ACGGGCGAAC TCGGCACCTA TCTCGAGAGC CAGCATGCCG      7500
     ATCTGCGCCA GGTGTCGCGG ATCGACTGGC GCGATTTGCA GAGCCTGATC GAGGGCGAGG      7560
     CAATCATTCT GTTTGGCGGC CGCCGCATCT ACGCCAAGCT CTTTCATGCC AAAGTCGACG      7620
     TCTCGGGGCC GATGCGCCTC AACCGCTGTC TGGCTTTGCT GCCACCGAAG CCTGAAGTGC      7680
     TTTCCCAGGA AGAAGCGCGT CTTTCGGAAC TGATTGCGAC CTTCCAGAAC GGGCTAATCG      7740
     GGTTCGGAGT GGAGGGGCCA AGCGATCCGG TGCTCGAGGC TGGCCTTGGC GCGTTTCGGC      7800
     AGGAGTTGAA GAAGGGCTCC TCGATCGACC AGGGCCTGCA GGAGGTCTTC GAGGCGATTG      7860
     ACGCGCTGCC GCATGAGCTC GCTCAATCCT CTTTGGTGAT CCAGAAAGAC GAAGCGCTGC      7920
     GTCCGATCAA GACTCCGTTC ACGGATCTTT TGGAAACGAG CCGAACCGGC TGGCCTTTGC      7980
     CGCCCGCGTC CTTCGGATTG CCGCGTGAAC CGATTGATCA GCGGCTCTTT CTCGACGTTG      8040
     TCGAAATCGA GAGGACGATC GGTGCGTCTC AATCCGCCGC TCGCAAGACA GCCCTCGATC      8100
     TGTTGGCGCT GCGCGATCTT GCCTTGAGAG ATGAACAGAA TGAGCCCCGG CCAGCTGTTT      8160
     CGGTCGAGGA TCAGAAACGT AAGCTCAGAA GCCTGATTGA GACATTCGAG GCCATTGCAG      8220
     AGGCAGGCGA GCTCGTGCCG ATTTAAGCTG AAAGGATCTT TCGATGATGG AAAGCCTGAT      8280
     CGTTGAAATG ACCACTCAAT AGTGCTAATA ATAGCACTAT TAATAAGCCC GTGGAGTGGT      8340
     CATATGGCGC ATATTGTTCT CGCTGAGATA ACAGCCAGCA TCTCGGAACT GAAAAAGAAC      8400
     CCCATGGGGA CAGTAGCGGC TGGAGAAGGC GCAGCAGTTG CGATCCTCAA TCGCAACGAG      8460
     CCAGCGTTTT ATTGCGTGCC TGCCCGCACC TATGAGGCGA TGCTGGAACG TCTTGAAGAT      8520
     ATGGAACTGA ACGCCATTGC TGACGCGAGA GCGAATGATC CTGTCATCAA GGTCAATCTG      8580
     GATGACCTAT GAGCTCGCTT TCGTGGATGC CGCTCTGAAA GAATGGCACA AGCTCGATAG      8640
     GAACACGCGT GAGCAGTTCA AGAAGAAGCT CACGGAACGC TGTGAAAATC CGCGCGTGCC      8700
     CTCCGCAAAG CTCTCGGGAA GCACGGACCG GTACAAGATC AAATTGCGCA GCGTTGGCTA      8760
     TCGGCTCGTC TATGAGGTTC GGGAAGCGGA AATTCTGGTG GTCGTGATTG CGATTGGGAA      8820
     GAGGGAACGC AGTGAAGTCT ATAAAGCGGC CGAGCGACGA GACCTTTAAA ATTGGCAGGT      8880
     TGTCATGCCA TGCAGCAGTC AGCATTCCCA GGCAAGATCG TTTAATTTCC GCATTGATCC      8940
     AGCCTTAAAC GGTGCCAGTG CAGCCTTAAT ATCTGTGACT GGTTTGTGCC TCCGTCTAAC      9000
     TATGCCGAAG TCAGCCTCGC GTTATAAAGC CATTGGCTAC GACGTGCCGG ATCCCCAAGG      9060
     CATTCACGGC CCGCTTATCA GTCGTCATCT TGTAAGAAGA GGCTCTTGAA GCTGAACAGG      9120
     CTGAACATAC AGTAGCTCAA GGTGTTTCCA CCTCGGAGTT TATCAGCCCA AATTCATTCT      9180
     TAAGTCATAT TGATTTAATA TAATCATTAT TATACACCGC CTTAATGATG TCGTCAGAAC      9240
     TATCTGCAAG ATCTTCCAAG CTTGACCTTA GCATTAGCAG TACAGAGAAT AGCATGGACC      9300
     TTTGGAAATG AATCTGAAAG GAGATCCCTT GAGTGTCATA TTAATATTAC ATCTTACTCT      9360
     GATCTATGAA TTGCTTGATG ATTAGCTCCT AAAACTCGTT ACTAGTTCCT CAAACTCGAC      9420
     GCAGTCGAGC ATATCAAGAT CAAGCCCTAA GCCAGGGTGA AGACTAGAAC CATTCCGCTC      9480
     TTCCCCGGCA ACGCCAAGCG GCGGCTTTCT CAATGCGCAG ACAGCCCGCA TCTTTGACTC      9540
     GGCGTCTCAC TCAGATGCAA TGGTTCCCGA CAAAGCGAGA GGACTCCTGT TCGGCCGCAG      9600
     ATCGCGCAAT GTCTATGACA TCGAGGATTT CCTCCTGCGA ACTGAGTTCA GACGGGCCGA      9660
     GAAAGCCCCA ATATGACAGT CGCATGTGCC ATTGTTCTGT ATTTTATAGT GATCGAAAAT      9720
     GACCTGCCGC GTGTTGGGCC GACGTCCTTG AAGCGGCCAT TCATTTGATC ATTGAAACCT      9780
     GAACCTGGAA AAACAAGAAC ATATGGCATG AGCAAATTCA CAGATCTTCT GGCGCTCGCA      9840
     ACGCCCGGTC TTTGGTTCGT CGAACCGGGC CAGAAACTGA TGGCAGACGA TACACTCCTG      9900
     CCGATAGATT GGATCAAATC CGGTGACGAT CTGGGCTGCA TCGGAGCAGC TCACTTCGTC      9960
     GGTCCTGGCG TGAACGAGCG GCAGCGTGGC TACGCTAATG CCCTGCTGTT CTCCGCCAGT     10020
     CGCGAAATGG CGCTTTTGCT CGAAGAAGCG CTTACTGTCT ATGATAACGA ATTTGAGAAC     10080
     GACCTCGAGA TTTCTGGTGC GGATCTCCTC GACTGGTTTT TCAACTGGCG CTTGCGTGTC     10140
     AAGCGGCTCG TCAACGAGCT ATGCTGAATT TTTCTAGCTG CCTGGTCGCA GGACACCATT     10200
     GCAATCGCCA CGACCAGTCA TTCAACTGTC CCCGCCAGAG ACACAAGATG TGCTGTCATT     10260
     CTGACGGCAG CTTGACCTGG CCCATCCTTG CCGCGCCTGC GCTCGATAAC GGTATATGTG     10320
     ATCGAGGGTA GCTGAGGCAG AATCCCGTCA GATAGCGGTG GCAAACCGAT CCCCACTTCG     10380
     GTACGGCTGG CAATACCCAG CCCAGCTTCA ACCGCTGTGC GGAGGCCATC AAGGCTGGGT     10440
     GTGACCAAAG CGATGCGCCA AGACCAACCT ATGGCATCCA GCGCTTGCTG TGCGGCCTTG     10500
     AGAAATGGGC ATGGTGGCGT GATGCTGACA AGCGGTAGTA CTTCCTCGGC CAGAAGATCA     10560
     GGCTTTCCAA ACCACTCCAT CGGAAAGCTC GTGACGGCTT TGCCGCGGCC AGGATCGTCA     10620
     GCACAAAGCG CTGTATCAAT CCGGTCCTCC CCCATCGCTT GCAGCAACTC CGCCGTACTG     10680
     CCGATAACAA TCTCAAATGT GGTATTGGGG TTGGTGGCTC GTAGATCTAT CAGGGTTGGG     10740
     CGCAAAACAG GGACAACGAA GTCCTGAACG ACGCCAACCC TTATCAGCGG CGTTGCTGCC     10800
     GGTCCCAATT CCGCGCGCGC CGCGTCAATC CTCCTGAGAA TTGCGCGAGC ATGACCTAAA     10860
     AGATGGCTGC CAACTTGATT AACCTTCAGT GCCCTGCCGT CACGATCGAA AAGCGGTTGC     10920
     CCGACAATAT TCTCAAGCCG TGACATTTGA AGGCTAAGAG CGGATTCACT GCGCCCAACC     10980
     CGCACGGCCG CAGTGGCGAG CGAGCCGCAA TCGACCACAG CAACAAAGCT GCGCAGCAAT     11040
     GGTGATGGCA GATCTGGAAT CATGAGATGT TCTCAAGTCA GATTTAACAG CTTTTCGATT     11100
     ATACTTTTAC AAATATGCAT GAAAATCCGG GTATTACGAA CCGGAGGTTA GAAATGCCCT     11160
     TTGCCAGACT GACGTTGACG TCGATCCCGA CACTGGATCA GGCCAATCAT CTTGCAACCG     11220
     AATTAACTGA ACTAATTGCT CATGATCTTG GCAAGCGACA GGAGCTCACT TCGATACTTG     11280
     TTGAGACCTC GGGTATTTCC CATTGGGCGA TCGGCGCTGA AGGTCGACTG ACTGCGGCAC     11340
     ATCTCGAAGT CTGCGTGACA GCCGGAACCA ACTCGGAGCA AGAGAAGCGG GCCTTCATTG     11400
     CAAATGCCAT GACAATCCTT CGGACAGTGC TGCCTGGTCT CAATCCCGCA ACCTATGTTG     11460
     TCATCAGGGA ACTTCCCGCA ACAGACTGGG GTTACGATGG ACGAACCCAA GCAGATCGAG     11520
     CGATGGATCG GATACATGGC ACTGCCTTAA TCGGACAAGA AAAGAGTTGA ACGTCCGCTC     11580
     AGGGCTGCAG GCGACTCTCC AAGAATATGG AACAAGCCTC ATCCTGAACC CCAATGTTCA     11640
     TTTCCCTGCC GCAGGCGAGG GAGAAGCTTC GTTTCGTTGC CGTGCTTCGG CCAGCTTGCG     11700
     CTGCTGTTCC TGGGTCTCGG CTTGCATCTC CTCCAGAAAC GAAGCGGCGC GCTTTGAGAG     11760
     AGCATCGAGC CGCTTTCCGT TTTCCTTGAT CGCGGCATTC AAGGCCGCGA CTTCCGGATC     11820
     GACCTGTTCC TGCACGACCT TGGCCCGAAT GAGCTGGCGC AGATCCCGGC CAAGCTCCTT     11880
     CGATTTGCCC TCCTTACCCT CAGCCTTGAG CCCAAGGGTC AACAAGGTCT CGACCGCCTG     11940
     TTCTCGGTGC CGGCGCAATG TGCCGATCAG ATCGGTTGCC AGCGGCTTGT AATTCTTCGT     12000
     GGCCATATCA GCGGCGATGC GCTTCCAGAT GTCCTCGGTG GTAACAGGAG AGGCATCACC     12060
     CAGGGCGCGG CTGCGCTTCT CAGCCTCATG GACGGCCGCT CCCGAAACCA GGGTCCATGT     12120
     GGCGCCGCGG CTCCGGCTTT CTGCGACATA GCCTTTGAAG CTGCTGATGC CGGCACTGCC     12180
     GCGCGGCAAG GCGTTGATAT GCTCTTCCGA GGTCAGGCCT TGGGCGGCGT CGATGGTCAG     12240
     GGCATGGCCA TAGCCGAGCA TCAGGCGCTG CGTCTTTGGA TCGATCAGAC GCCTCATTTC     12300
     AACGGAGCCG ATCCGGCCTT TCTTGTCCTT GAAAGTGAAG CCATCGGCAC TTCTGCCGAC     12360
     AACCTCGACG ATGTCGCCAT TGTCGCCGAT CGAGCCGCCC TTGCCATCGA TCGTCGCCCA     12420
     AGTGCGCCGA TAAAGGCGCA GCTTGTCGCC CGTGGCGATC CGGAGGTCAT AGGTCTCGCC     12480
     GCGCTGGTCG ATCGCCTTAT AAAGCTTTTC ATCGGCGCCG ATCTCGCCAC GCGCCTTGAG     12540
     CCGTTCGCGG ATGGCCTGGC TGATGTCGGC CGCATCCTGA TTGGTCAAGG CGGAGACGGT     12600
     GATGCTCTTC TTCGGATCCT CCGCGCGCAG GATGTCGCGA CGCTGCATGT AGAGGTCTGC     12660
     GATCTGGCCG ATGACCTGAT CCTGATCGCC GCCGAGGAGG CGGGCGGTGC CATCCTCGAT     12720
     CTTCATCCCC AGGGCCTCGC CGGCCTTGCC TTCCCGGAAG AGATTGGCGA TGTCGCGGTC     12780
     GCGCCGCGTG CGCTGGCGCA CGGTCGTCAG GAGCGCGGGC AGGGCCTCCT TCGGGAGGAC     12840
     GCGCTTCAGG ATCTCGATCG TGTCGCCGGC TTCGATCGAC TGTGCCTGTT CCCGGTCGCC     12900
     CAGGGCCTTG ATGGTCATGC CGGTCTCGGC CTGGACCTCG AGGAGCTTCA GCATGGCGCG     12960
     CGGGCCGATC TGGCTGACTT CGTCGATCAC GATGACAGTG TTGTGGGTCG GCTTGACGGT     13020
     TCCCTTGTCG ATGGCTTGCA GCAAGGCCTC GACGCCGGCT GTCTTCTCGA TGCCGGCATT     13080
     GGCCAGGGTT GTTGTGTCGG GCTGGCCCTC GACGCCAAGC GATTGCAGGA AGGGCTGAAG     13140
     GGCGACGGTC TTGTCGATAC CAGCATCCTT CAAGGCATCG GCTTGCCGCC AGGCGGTGGC     13200
     AACGCCGATC ACTTCGCGGC CACCCGCATC ATAGCGGGTG TCAGCCTTCC AGGCGGCGAC     13260
     GAGGGGTTGC AGGAGTGTCG TCTTGCCGGA CCCGGCCACG CCCGTCAGGA GGGTCAAGCG     13320
     CCCGCCCTCG CCGAGTGCAT GAATCGCCGC GCGCTGCGCC GCTCCATGTT CGGGTTCAGT     13380
     GGTGAAATCC AGGCCGGAGG CGTTGATCGC TGCCTTGACG GTTTGAGCAG AGAGCGCGCC     13440
     GTCCTTGTCC CGCGCTACGG CCCGGGCCTT ATTGGCGAGC TCGGTCTCGA TGCGGATCTG     13500
     CGCCGTATTG GTGATCCGCA CCTTGTCCTC CATCCGGCTG GTAATCAGCG CCACATGCTC     13560
     GCCCTGGAGG GTGAGGCCGC GTTGTTCGAG GAGAGTGACC ACTTTGTCGA TGTCGTCGCG     13620
     ACCATGGGCT ATGCCGGCAC CGATGAGGCC ACGCACGGCA TGGACGCGCA ACCGATCATG     13680
     GTTGAGGACG GCGGCCGTCT TGAAATCCTC GGCCAGGCGT TTGGCAGCGA AGTCATAGGC     13740
     TTTGTCGTAG CGCTCCGCGT CGGTCAGGGC CTCGTGCCTG ACCCCGTTCA GGACGGTTTC     13800
     ATGCCGCCAG CCGATGGCTT CGGCCTGGGC CTTCCAGGCT TCCTTTTCGC CCTTGCCGTC     13860
     TTGCTTGGCA TAGCGCGAGA CGACGCTCGA TTCATTGAGG ATCGTTTGCT TGCGCTCGAT     13920
     CGAGAGTTCG TCCCAATCAA GGCCCTGGCT CTTGGCGAAA GCCTTGGCCG AGCGCAGGAC     13980
     CTGCTGGCGG CGCTTGCTGA AGGTGTCCAC CGCCTTTTGG GGAATGGCCT CGAGAACGAC     14040
     GGCTTCGTCC TTCTTGTCAT AGCCGATCTC GGCGCCGAGG CGGCGCAACT CGTCGGCGAG     14100
     GCGGGCCTGG AAATAGCCGC CGAGCTCATG GGTCAGATCG GACGTCAGCT CCTTGGTGTT     14160
     GAGCGATCCG ACACGGCCAT CGGCCGTGAC GACCATGTTC ATCAGGAAAT TATGGATATG     14220
     GGCCTGGGGA TCGCCCGCTG TCTTGGCCTC GACCAGATAG GTCGCCCCGC TTTTGCCGTC     14280
     CTGCAGCTCG ACGGTCGGCC GGGCGACGTG ATGCCGGAAG CTCACCCAGC CGACATCACC     14340
     GGGATCGACG CCTTCCTCGC CGCCTTTGCC GCGCCGCGCG AAACCGAGGC GGCCGGCCGC     14400
     ATAGCGCATG GCGGCATCAT TGGCGCGGTC AATAGCGTTC CAGATCGCCG CGCTTTCAGC     14460
     GGGGGTCACG GCGAATTCGG CGGCGATCGT CACCGATTTA TGCGGCGAGA AGGTGAAATC     14520
     GAAACCGGAT AGCGTTCGCT CGTGCTGGGA CCAGCGCTCC CCATTATCCC CCCGCTTGCC     14580
     CTCGAAGAGC CGGTCGAGGG CTTCGCTGGT CGGCATTTGG CTCGGATCGA TGCCCGCGGC     14640
     CTTGGCGAAG GCCGGGGTGA TGTCTGGCCT CCAGGTGGCC CGGCTATCGC GGCCGGTATA     14700
     ATAGGACGTC AATCGGCTGC CCGGTTCGAG CTGTTTTTCT GGATGTTTGG TCGGGTCGTG     14760
     GATGGGCGCG GTCTTGCCTT CGGTGAAATA GGTTCGCAGC ACGACGCCTT GGGAATCCGC     14820
     CGAGATCTTG CGGAAATTCA TCATCGGCGG GCATCCCCTT GGCCATTTGG CGCGGCCGGG     14880
     GTTTCCCTGC CCATCTGCAG GAGCTTTAGG ATCTGCTGCA GGAGATTGAG CTGGTCTTTG     14940
     CTCTGCCGGA CGAGGTCGGT GAGGAGTTTA TCGAGCGGAA CCCGGTCGGG ATCCATTTCG     15000
     GGAGGGGTAA GAAGCTCGAG GATTAGGGCG TTCTGCTTGA CCAGGGTGCC GAGGATCGCG     15060
     GTTTGCTCCG TCTGCACCAT CTGAATGGCT TGCAGGCGAT TTTCGGTCGT GGGTTCTGGG     15120
     CCGGTGGAAG AAATGGCCAT GTGAGGTCTC CGGAATGGAT GTTCTCAGCA TGGCCAGAGG     15180
     TCGTGAGAAG AGCACACATC TTCTGGCTGA TGCCTAATCA AAAGCACGCA CACAACAGCA     15240
     AAAACGATTC AGGCAAAGAA GTCGGCTTGG CCAAGCGAGT TCGTTACGAA TGTTATAGGA     15300
     AGCATGGATC AGTGTTCCCG CTCCGATCTT TACATCTTCA TCTTCGAAGC CCGAAACAGG     15360
     TGGCCTGAGG GCTTTGCCCA CGCGGTCCAT GGACCGTTTA AACCAACTCC TACTTCTCAT     15420
     ATCACGCAAT TGTGATATGA GAATGCGCGC ATAGGTGGAG CCAGACATAT TGCCAGCTAA     15480
     GGTTTAGCTA GTACTATGAA AAATATTTTA CAGCTTCAGT ATCAACCAAT GATTTTGCTG     15540
     TCGAGAGGGC GGATGACGCA TGCATGCCCG CAGAGAGTCT AGATCATCGG TGGCTTGGCC     15600
     GTGGCGGCGT TAGACCTTTA TGCGTCATGA CGAGGAATAG GCTAGTCATC ATCGTAATTT     15660
     GGTTTTCGCC TTAACGGAGA GTTTCCCATG ACGTGGAAAT TTAAAACAAA GAAAGGGGTT     15720
     TTTGATTACG CCCCTGAATT CGAAGAACAG TATTCAGTCA ATGATGATGG CACAGAAATA     15780
     CGCTTAGGTG GCACAATTAG TCGCTCATAT ACGCACTTAT CCTTTGAATA TGAGGGACGA     15840
     GGTGTAAAAT TTAGATTTTC CGCGATGCCT ATTACGGAAT ATATAAAAAA AAACGATTTA     15900
     TATAACCTAG GTAAAGTATG TACGGTATAT ATATCATCGG CAAACAAGAT TTATATAAGC     15960
     CACGATCTTG GACTAAAGAT CGCAGAAGAC ATCCGCGATA TGCTTATAGA TACATATAAA     16020
     TACTATAGAT TTAGCGGCGA TTCTCATCTT GAGGATGTTG TCTTCGATCA ATACGCCAAG     16080
     GCATTCTTAA ACATTTAATA TGCAATACGT AATAAAGGAA ATTATATTAT GCTTGACGCT     16140
     ACGACGCTTG CGCAGCTTCA GAATATAGCT AACGCTCAAA CCAATGTCGG CGTCAAGAAT     16200
     GCTGTAGTCA ATATCATAAA CCTCGCGACC GGGAGCAATC CAGCCTCAAG CACTTTGGCG     16260
     CAAACTGTCA ACACATTGCT TGGCGGCCCG AACGGGCCGA TGTCGGCCAA AGCCAATGGT     16320
     TCTGCGCTAT TCTATTCGGA CGACGACAAC AATCCAGGGA AGCCCAACCT CCAAGCGGCA     16380
     AAGGACTGCC AGACGAGCCT AAAGGGGAAT GGTTATTTTC TGGCCGACAC CCAAGCAGGC     16440
     GTGGCCGCAG AAAAGTTGGC AAATCAGGCT GACGCCTTGT CAGGCGCCGT TAATACTTCG     16500
     CCAGCTGGCG ACGCCATTAT GGGCCTAGCG TCGGCGATGA TGGGCGCGCA AGCGGACAAC     16560
     GCTTATGCCT TCGTCAGCAA CGCCTATTCC GGAAGCATTT GGACGCAGTA CGAACTGCCG     16620
     GCGCTCCTGG GTCAAACGGG CAGCGAAGTG GGCACCGTCA ACGGGCTCAA CCTGAGCAAC     16680
     TACAATAATT ACAGCCCCAG CCAAATTCAA AATCTGATCA GCGCGTCTCA GGCTTGCGAC     16740
     CCAAATAACC TTCCGCCTCC GACCGGCGGC GTTCCTGCGA ATGATAACCT GAGCACAACG     16800
     CAGATGATCG CGCTAGGCCT GCTCGGCGCG GCGACGACAG TCGGTGTTGG CGCCTTGATC     16860
     ATTTTGGGCG CGCCTGTGGA AATTCCTGCG CTTGGTGTCG GCGGAATAAT GTTGTTGCTA     16920
     ACAACGAGTC AAGCCGCCGC TAAACCTATT GCGCCGACAA CCACGGATGC GGCGTCACAA     16980
     TATCAATTTC AGTGGCAACT CAACACCTAC AATGGCGCTC AGATTGCACC GGCGCTCGGC     17040
     TATATTCTGG CGCAGGCTCA GGGCGCGCCA AATGTGTCGT CACTTGCAAT GCAGGTTCAG     17100
     CCGAGCTTGG TCAGCCTTCG TAACCTTGTG ACGCAGAGCA ATTCGCCATT GTTCGCTCAG     17160
     ACGACCGATT CTTCTGGAAA CTTGGTGAAT GTTACGATTC AATCGAACTC AAGCAATTCA     17220
     CTGCTAATTC AGTTGGCTTC CGCGACAGCG ACCACGGCGG TGAATCCTGC GACAATCGAT     17280
     GTCGGCTTTA ACAATTCGGG CGGAACGTCA TTTGAGCAAA CAACTGTAAC CAACGCCAAT     17340
     GGCTCGGCCG CGGTTTTGAT CTCAGGAGAC GACAATAACG CGTCAATCAA CAATTCTACC     17400
     ATTTCCCTGA ATTCAGGCGC GACAGCTACG ATCACTGGAA ACTCCAACAC CTTCGCCCTC     17460
     GGATCTGACT CCTCCGTCAC GCTGAACAGC CAGGGCGGGA GCAACACGGT GACCGTGACA     17520
     GGTGACCCGT GGTTCAGCTG GCTGGCTTCG CAGACGACGC GGTTCGAGGC GGATGCGAAC     17580
     GGTGTCCGTG TGGGTTACCC CGGTGGCAAT CTGGGGACGG ACTATTCTCT CAATGACCAA     17640
     GGACAGATCA CGGCGGCGCC GGTCTTCATG GGCTTCGGGC TGGGCGGCGG CTATGCCTCG     17700
     GACAGCGCGG AAGCGGGCAG CCTGCAATCG AGTGTGAGCG GCACGATTCC GGCCGACACA     17760
     TCGTCTGGCC CCCCTCTCGA CGCCTGGCTG TCGTCGGTGG TGGTGATCAA TCTCGGCGGC     17820
     GGGGTGGGCA GCGGGACGCT TTATACCGCG CCGTCAGGCT TCATTCAGGG CGGCCGCGTC     17880
     CTGAGCTCAA CCGATATGGC GGTGATTTAC CCCAACGCCA ACAATGACGG CGTCTTCAAC     17940
     AATTCCCCTT CAGGCAATGT CGCCGGCTAT AATCGGTCGG CCAATGACCA GCTGTCGGCT     18000
     CCCTCCCAGA ACCTGCAGGA CCTCGTCGGC GGCACGGTTT CGGCGCTGCA GACCTTATCA     18060
     TCGGTGAGCC CGCTGTTTGG AGCCGCCCTT GCCGACATGG CCAGCAACGC CAGCAGCTGG     18120
     ATCAATACCG ATCCCCTGGT GATCGGCACG ACGAGCGCCG GCATCACACT GACCAATTGG     18180
     ATCTCCAATG CGGTCTATTT CGATACCAAT GTGAACCCCA CGACCTTGCA GGCCGATGGC     18240
     AAGCTGCATC ACACCAGCTG GGTCTCGGGT GGCACCGGCA TCGTGGCGCT CGACCGCAAC     18300
     GGCAATGGCC AGATCGACGA CATCACCGAG ACCCTGTCGG AGTTCTTCCA GGGCGGCTCG     18360
     AACCCCGGCC ATTACGCCGA TGGCCTCGAT GCGCTGAAAA GCCTGGCGCA GGCGGGGGCG     18420
     AGCGTGTTTT CCGCCGCGAC CTCTCTGACC GATCCCACGA CCCACCAGAG CTATTGGAGC     18480
     GAGCTCAGGG TGTGGCTGGA CGCCAACCAG AACGGCGTCA CCGATGCGGG CGAGTTGAAG     18540
     ACGCTGAATG ATCTCGGCAT CACCTCGATC AATCTTGTGG GCTCGGGCAA CCTGGGGGAA     18600
     TCGCTGGAAG GCAGCGCGGT GACCAACCGC ACGACCTATA CGAAGAGCGA CGGCAGTAGC     18660
     GGCGCGGTAG CGGCGGTGGA TTTTGCCACC AATACGGTCG GCGACATCGC CACCTCCGCC     18720
     AATGGCGGCA TCACCATCCA GTCAGTGCCG GAAGGCGGCG CGACGCCGTC GAACAGCTTC     18780
     GTCATCAAGA ACACCTCCGC CCATGCCTAT ACGCTCTCTA ACGGGCAGCT CATTGATAAT     18840
     ACGACGGGGC AGACCGTCAT CGCCAGCGGC ACCAAGGGTG TCTTCAGCAC CAATCAAAAC     18900
     GACAGCATCG CCGTGGCTTC CAGCGATCCG ACACCCTATT GGCTGGGCGG CGGCACTGGC     18960
     GCGGCGACGC TGACGGGGGG CGCGGGCAAT ACGGTCTTCT TGATCAATTC CAAGACCATC     19020
     GTGCATGGCG GCACGGGCTT CAACATCGCC GAGGTTACGG ACGCCAAGCC CATCACCGTT     19080
     GATCTCAAGA CCGCCAATCT GCAGGAGGTC ATCGGCGGTG CGGGCGACGG CGTGTTCAAC     19140
     GCCTCTGGCA CCAATTGGAA CGTTTTCATC CAGGGTGGTT CCGGCAATAA TATCATCATC     19200
     GGTGGGACCG CCAATGACGC GCTGGCGGGC GGTACGGGGG ATGACCTCAT CGAGGCCGGC     19260
     ACCGGGGGGT CGGTCATCCA TGCGGGAGCG GGCAATGACG TGATCTACGG CGGCTCGGGT     19320
     TCGACCTCCA CGGCCCAGCC TGCCTATGTC AATGCGGGTA ATACCGCCGA TATTTCCTAT     19380
     GTCGAGCGGC TCTACGAGGG CGGCTTTGGC CGAGAAGCCA GTGCTGGAGA ACTGCAATGG     19440
     TGTGTGTCTG TTCTCGGCAA TGGCAGCGTA GACCGAGTGA CGCTTGCCTC ATATTTCCTC     19500
     AGTAATCCAG AATGGCAAAA CCGGTTCGGG ACACAGACCG ACGCGCAATT TGTGACGAGC     19560
     GTGTTCGATA ACTTCCTGGG GCGCGATCCC AGTGCCGGGG AACTGGCGCA GTTCACGCAA     19620
     GCTCTTGCCG ACGGAGCACC CCGTAGCTAT GCGCTGGAAT CAGTCGCTGA CAACGCTCAA     19680
     TCCCAGACCT ATTGGGGGCT CCACCACCCG GGCGCGAGCG ACGTCATCTA TGGTGGCTCC     19740
     GGTCATGACA CGATCGTGCT CGGCACCAAC AATGCCGTGG TCTATGCCGG CTCCGGAACG     19800
     ATGACGGTGG TCGGCAACGC CAATGGCTTC TCGACCGTCG GCCTGCACGG CAGCTATGCC     19860
     GATTATACGC TAACCCATAA TGCCGATGGG ACGATCACCG TGACCAATAT CGGCCATGAA     19920
     GATGGCGACG GCACGGTGAC GATGAAGAAT GTCACGGCTC TGGATTTCAA GGACTTCATC     19980
     CAGGTTGATA TTGCCACCGC CCTGGGCATG CCGGTCGATG ACACGTTGAA CACCGGCAAC     20040
     GCCAGCCAGG TCACGGTCAA TGCATCCGGC CAATATGTGA TCAGCGCCAT AACGCTGCTC     20100
     GCCAATGATC TCGATTATGC GGGCAAATCG CTGTCGATCC GGGAACTTCT CGACAATAAT     20160
     GGCAATGCCA TCGCGCGCGG TTCGAGCGGC CAGGTGAACG GCGGCATTGC GATGCTCAGT     20220
     ACGGATGGTT CGAGCATTAC CTTCACACCC ACGCCGGGTT TCGCCGGGGT GATGAGCTTT     20280
     CGCTATCACG TCGAGGACAG CGACGGCCAG ACCGGCCAAT CCGTCGTCCA GACCGGTACG     20340
     TCCAATACGG CGGAACTGGC GGCGACGGTT TCCCTCGTCA CGCCGTCTCA GCCGACCGAC     20400
     CCTCTTTTCG CCAAGGAATG GTTCCTGCAG GCGGCGGATG TCATCCCGCT GCTCAAGCAC     20460
     TATACCGGGG CGGGGGTTTC CGTCGGCATT TTCGATGGCT CCGGCAATGT GGATTTCTCC     20520
     AACCCGGATC TTTCAGCCCA TGCCGGGCAG TCGGTCAAGC TCGACGGCAC GCCGGGGATC     20580
     ACGCAGACCG GCACCCATGC GACCCTCATC GCGGGCGTCC TCGGCGCCGC CATCGACGGT     20640
     GAAGGCGCGG TCGGTGTGGC GCCCGACGCG ACGTTGAACA GCGAGGCTGT TGGCCTCGTG     20700
     GGGATGTCGA CGCAGACCGA TGCGAATCTC ATGGACTGGT CGAATTACGA CGTCGTCAAC     20760
     AATAGTTTCA GCGTGAAGCC TCCCTTTTAC AATCTCGGCC TTTCCCCTGC CGGTTCAGCG     20820
     TCGGAACTGA CGGCGTTTCT AAACGCGATC CAGAACGGGC GACAGGGCTA TGGCACGATC     20880
     ATCGTCATGG GAGGCGGCAA TAGCCGCGCC CAGGGGGAAA ACACCAATGA TTCCTATTTG     20940
     ACGAGCTCGC CCTATGCGAT CACGGTCGGC GGAATCAATG CCACGACCGA TCTGTCCACC     21000
     TTGCGGATTT CCGGGGCACC GTTCAGCGAT CCCGGCTATT CGATCCTCAT TTCGGCGCCG     21060
     GCCAACAATA TTACCTCCGA CGGAGTGGCC TACACCAATG CCTATGGCCA GAACTTCGGC     21120
     TCCACCGTCA AGACAGCGGA AGGAACGTCT TTCGCGACGC CGATCGTGTC CGGCGTGGTC     21180
     GCTGATATGC TGCAGGCCAA TCCTTATCTC TCCTGGAAGG ATGTACAGCA GATCCTCGCC     21240
     TATTCGGCGG TAAAAGTCGA TCCCAACGAT ACCAATCCCT TTGTGGCCGG CTCAACAGCA     21300
     GGATCGGGCT GGGCCTTCAA CGGGGCGACG AATTGGAACG GTGGCGGCCT CCACTATAGC     21360
     CCAGATTACG GCTTCGGCGA AGTCGACGCC CGCGCCGCAG TGCGGCTGGC CCAAAGCTGG     21420
     AGCAGCTTTG GCATTTATAC AGACGTTTTC TCCCATGATA CTTATGTCAT TAGCACTCCT     21480
     TTATCATCGG GACCCTTTTC CAAAACTTTC ACAGAATCCT CGACGACGGA CACCGTCGAG     21540
     ACTGTTCAGG TGCGTGTCAA GATCTCGAAT GCTATTCGTA GCAACCTGAC CATTACATTG     21600
     ATATCGCCGT CCGGCGTCAC CAGCACGCTC ATGGCGCGGC CTGGATCGGT CATCGGCCCA     21660
     ATCGCGGATG CGGCGAATTT TGTTCCGGGG GCCTTCGATG ATTTTACGCC AGGCACGTTT     21720
     GATTATACGT TCATGACACA GGCGGACCGT GGGGAAGCCT TTCAAGGCAA TTGGACTGTC     21780
     AACATCTCGG ATGCCGCTGG ATCCACCTCC CAGGCGATTG TAACAGACGT CAAAATTATC     21840
     CTACAAGGCA ACTACACGGC TGGTAAGCCA CAGACATTCA TTTATACAGA CGAATTCGCC     21900
     ACTCTCTCAA GCACACCGGG CAATGCTCTC TACGATCCGA ATAATGCCGC GCGGTTTACT     21960
     CTCACGGGAT CAGGCTATCA GGATACACTG AATGTTTCGG CAACAACCGG GGCGGTCAAT     22020
     CTCGATCTTG TCACCGGCTC CACCGACAGC ACCATCGACG GCCGTTATCT TGCCATTGCG     22080
     CCAGGTTCAA AGATCAACAA GGTTTACCTC GGTGATGGTG TTTCAACGGT CCATCTCAAT     22140
     GCCGATAACG ACATCATCAA TACGGGCGCC GGCAATGCCA TTCTTTATGG CGGGGCGGGG     22200
     TTTGACATCT ACAACATTGG CAAATGGCTC CAGCGTTCGA TCCCTGCTGG GAACACAACC     22260
     ATCTATGGAG GCAGTGGTGG CAGCGCGGTC TATATCGGGG ACGAGGCGGG TAGCAACATA     22320
     TTGGTCGGAG GAGCTGGCGT TGACACCGTG TCCTATTCCT CGGCCTCTGC GGGTGTCACG     22380
     GTCAACCTGG GGGTGACGAC GGCGCAGGCC ACCCGCAGCA CGGGGACCGA TACGTTGTTG     22440
     GGCTTCGAGA ACCTGACCGG CTCGGCCTAC AACGATGTGC TCACTGGCAA TGGCGGCAAC     22500
     AATGTCATCG ATGGTGGGGC CGGCAATGAC ACGATCGACG GGGGTCCCGG CAACGACACA     22560
     CTGATTGGCG GGGCTGGGAT CGACACTGTG AGCTATGCCT CGGCGACCTC CGGGGTGACG     22620
     GTGAGCCTGG CCCTCACCAC GGCGCAGGCC ACGGGCGGGG CCGGAACCGA CACGCTGTCG     22680
     GGCTTCGAGA ACCTGACCGG CTCGGCCTAT AATGATGTGC TGACAGGCGA TAGCGGCGAC     22740
     AATGTCATCG ACGGGGGTGC CGGCAATGAT CTCATCGACG GGGGCCTTGG GAACGACACG     22800
     CTGATTGGCG GGGCCGGGAT CGATACATTG ACCTATGCCT CGGCGACCTC CGGGGTGACG     22860
     GTGAGCCTGG CCCTCACCAC GGCGCAGGCC ACGGGCGGGG CCGGAACCGA TACGCTCTCC     22920
     GGCTTCGAGA ACCTGACCGG CTCGGCCTAT AATGATGTGC TCACTGGCAG TGGCGGCGAT     22980
     AACGTGATCG ACGGCGGAGC CGGCAATGAT CTCATCGACG GGGGCCTCGG GAACGACACG     23040
     CTGATCGGCG GGGCCGGTGT GGACACGGTG ACCTATGTTT CGGCGACCTC CGGGGTGACG     23100
     GTGAGCCTGG CCCTCACCAC GGCGCAGGCC ACGGGAGGGG CGGGGACCGA TACGCTCTCC     23160
     GGCTTCGAGA ACCTGACCGG CTCGGCCTAC AGCGATGTCC TGACAGGGGA TGGCGGCGAC     23220
     AACGTCATCG ACGGTGGCGC CGGCAACGAT ACCCTCTATG GCGGGGCTGG CAACGATACG     23280
     CTGATCGGTG GGGCCGGCAA CGACAAACTC CAGGGCGGCG CCGGCGATGA TACGCTGGAT     23340
     GGGGGCGCCG GGACCGATGC GGCAAGCTAT ACCCAGGCTT TGGCTGGCGT GACGGTGAGC     23400
     CTCGCCGTGA GCGGGCCGCA GAACACGATC GGGGCGGGAA CCGATACGCT GCTGAATATC     23460
     GAGAACCTCA CGGGCTCGAT CTATGACGAT GTGCTGACCG GGGATGCCGG CAACAATGTC     23520
     ATCGATGGTA ACGCCGGCAA CGATCTCATC GACGGGGGCC TCGGCAATGA CACGCTGATC     23580
     GGCGGGAGCG GGACCGACAC GGTGAGCTAT GCCTCGGCGA CCTCCGGGGT CACGGTGAGC     23640
     CTGGCCCTCA CGACGGCGCA GAACACCGGT GGCGCGGGCA CCGATACGCT GTCGGGCTTC     23700
     GAGAACCTGA CCGGCTCGGC CTACAACGAT GTCCTGACAG GGGATAGCGG CAATAACGTC     23760
     ATCGACGGCG GCCTCGGCAA CGACACGCTG GATGGTGGGG CCGGTGTGGA TACGGTGACC     23820
     TATGTTTCAG CGACCTCCGG GGTCACGGTG AGCCTGGCCC TCACCACGGC ACAGGCGACC     23880
     GGAGGGGCGG GAACCGACAC CCTGTCGGGC TTCGAGAACC TGACCGGCTC GGCCTACAGC     23940
     GATGTCCTGA CAGGGGATGG CGGCGACAAC GTCATCGACG GTGGCGCCGG CAACGATACC     24000
     CTCTATGGCG GGGCTGGCAA CGATACGCTG ATCGGTGGGG CCGGCAACGA CAAACTCCAG     24060
     GGCGGCGCCG GCGATGATAC GCTGGATGGG GGCGCCGGGA CCGATGCGGC AAGCTATACC     24120
     CAGGCTTTGG CTGGCGTGAC GGTGAGCCTC GCCGTGAGCG GGCCGCAGAA CACGATCGGG     24180
     GCGGGAACCG ATACGCTGCT GAATATCGAG AACCTCACGG GCTCGATCTA TGACGATGTG     24240
     CTGACCGGGG ATGCCGGCAA CAATGTCATC GATGGTAACG CCGGCAACGA TCTCATCGAC     24300
     GGGGGCCTCG GCAATGACAC GCTGATCGGC GGGACCGGGA TCGACACGGT GACCTATACC     24360
     TCGGCGACCT CCGGGGTCAC GGTGAGCCTG GCCCTCACGA CGGCGCAGAA CACGGGCGGG     24420
     GCGGGGACCG ATACGCTCTC CGGCTTCGAG AACCTGACCG GCTCGGCCTA TAACGATGTC     24480
     CTGACAGGCG ATGCCGGCAA TAACGTGATC AACGGCGGCG CGGGCAATGA CATCCTTGTC     24540
     GGCAGCGCGG GGAGCGATAC CCTGGATGGC GGCGCCGGCA ATGATGTCTA TATCTACCAT     24600
     CAGGCCGATG GCAACATGCT GATCCATGAT GCCGGAGACA GCAGCGGCCC GACGCCCTTC     24660
     AATACCCTGT CCTTCGCCGA TCTCACGCTG TCCAATCTGC TGTTTTCACA GAGTGGCACG     24720
     GATCTGGTCA TCGGCATTGC CGGCACCGGC CATTCGATCA CGGTGCAGAA TGAACTGGGC     24780
     GCTTCAGGCC TCGACGGCAT CCAGCAGATC AATTTCGCCG ATGGCTCCAA CATGACGCAT     24840
     GCGCAAATCC TTGCGCATGC CTGAGTTTTG CTTTTCCAGA CGGCGGCACG GTTTGGCGGG     24900
     CTGCCGTTTT CTTCCTTTTT TCTTCTTTCT TTTCTTCCTT CCTTCTTTCG GCTTTTTGCA     24960
     TGAACAGTTC TGCTGGTGAT CCTGCCTCCG GCACACCACT CGATTCCGGC CTCTGTGCTC     25020
     TTGTCGCCAT CGCGGGCTTC TATCGGATCG CCGGCGATCC CTCACAATTG GCGCATACAT     25080
     TGGCCCTCGA CACCCGTGCG GCCGACGAAG AGGATCTCGT GCGCGGCGCG CATTGCCTCG     25140
     GCCTCAAGGC CCGCCTCCTT CGTCAGGCGA CGCCGAAGCG TCTGGCGGTC TTGCCAAGGC     25200
     CGGCCATCGC CCGCTTGCGC TCTGGTTCTT TTGCCATTCT CGGCCATGCG ATGGCCGACG     25260
     GCACGCACCG GCTCATCGAT CCGCTGACGC GGATCGAGCG CATGATGCCC CTCGACGATC     25320
     TGGTCGCGGC GATTGAACCC CTGGTGATCC TCGTCGCGCG TCGTTTCAAT GGCGTCGGCA     25380
     CCGATCCAAA GACTTTCGGC TTCCGCTGGT TTTTGCCCTC GCTCTGGCGC TATCGCAAGC     25440
     CTTTGGGCCA TGTGCTGCTC GCCTCCTTGT TCGTCCAGCT CTTTGCCCTC GTCACGCCGC     25500
     TGTTCTTCCA GGTGGTGATC GACAAGGTGC TACCGCACAA GGGCTATGCC ACTTTGTTCG     25560
     TGCTGATCGG CGGTCTCGTC CTCGTCGGCC TGTTCGATGC CGTGCTGAAC TATCTGCGGA     25620
     CCTACGCCCT GTCCCATACG ACGAACCGCA TCGACGTCGA ACTCGGCCAG CGCCTCTTTC     25680
     AGCATCTCCT GCGCCTGCCG CTTGGCTATT TCGAGAGCCG TTCGGCGGGA CAGACGGTGG     25740
     CCCGCCTGCG CGAACTCGAG GTCATCAGAA GCTTTCTGAC CGGCCAGGGC CTGTTTTCGG     25800
     TGATCGATCT GCTCTTCACC TTCATCTTCA TCGGCGTGCT TCTCGCCTAT TCCTGGCCAT     25860
     TGACGCTGGT CGTCCTCGCT GCCATCCCCT TCTATGTTCT GATTGCCGCC CTGGTGCGGC     25920
     CGCCCCTGCG CGACAAGATC AAGGAGCGGT TCGATCGCGG CGCCGAAAGC CAGCAGTTCC     25980
     TGGTCGAGAC GGTCGTCGGC ATGCATACGG TCAAGGCGAG CGCGGTCGAA CCGCTGATGC     26040
     AAGCGCAATG GGAGGAAAAG CTGGCCGCCT CGGTCAAGAC CGCCTTCAGC GCGACGCTGC     26100
     TCGGCGCCGG CGGACAGAAC GCCATCACCT ATGTCAGCAA GCTGGCGCAT GCGGCGCTGC     26160
     TGCTGTTCGG CGCCAAGGCG GTCATTGACG GCGACCTGTC GGTCGGCGCC TTCATCGCCT     26220
     TCACCATGAT CGCCGGCCAG GTGACCCAAC CGGTGCTGCG GCTATCGCAG CTCTGGCAGG     26280
     ATTTTCAGCA GGTGCAGATC TCGGTCGAGC GGATCGGCGA TATTCTCAAC GCGCCGCCGG     26340
     AACGGTTCGC CGCGACCCTG GTGGCTCTGC CGCGCCCGAC TGGCGCCATC GAATTGCGCA     26400
     ACGTCAGCTT CAGCTATCGC CCGGGCGCCC CCGCCATTGT GAAGAATCTG TCCCTCGCGA     26460
     TCCCATCCGG CGCGGTCGTC GGCATCGTCG GCCCCTCCGG TTCGGGCAAG TCGACCCTCA     26520
     CCAAACTGTT GCAGCGCATG TACATGCCGG ATGAGGGTCA GATCCTGTTC GACGGTCTGG     26580
     ACATCGCCCA GTGCGATCCC GCCTGGCTGC GGCGGCACAT CGGGGTCGTG CTGCAGGACA     26640
     GCCTCCTCTT CAACCGCACG ATCCATGACA ACATCGCCTT TTCCAACCCC GCGATGACAC     26700
     GGGCCCAGGC CATCGCCATG GCGCGGCTCG CCGGCGCCGA TGCCTTCATC GGCCGCTTGC     26760
     CGCAAGGCTA TGACACGCTG ATCGAGGAGC GCGGCGCCAA TCTGTCCGGC GGCCAGCGCC     26820
     AGCGCATCGC CATCGCCCGG GCGCTCGCGT CCAATCCGCC GATCCTGATC TTCGACGAGG     26880
     CGACCAGCGC CCTGGATTAT GAGAGTGAAC GGATCATCCA GGAGAATATG AAGAAGATCA     26940
     CCAAGAACCG CACGGTGATC ATCGTCGCCC ATCGCCTGGC CGCCGTCCGG CAATGCGATA     27000
     CGATCCTCGG CATGATCGAG GGCCGCATCG TCGAAGCCGG CACCCATGAC GAACTCCTGG     27060
     CGCGCAAAGA TGGCCTCTAT GCCCGCCTGT GGCGCCTGCA GAACGATCCG GTGGCGGCAT     27120
     GAAGCGGGTT CTTGCCTTGC TGGGACGCCG AGGGGAACCC CGCGCCTTCC GGCCCGATCA     27180
     GGAGTTTCTG CCAGCGGCCC TGGCGATCCT GGAAACACCC CCCTCGCCGA TCGGTATCGC     27240
     CCTGTTGTGC ACGATCTGCC TGCTCGCCGT CACAGCTCTT GCCTGGGCCT CGTTCAGCCG     27300
     CATCGATGTC ATCGCCGTGG CGCAGGGCAA GATTCAGCCC GCCGGCCGGG TCAAACCGAT     27360
     CCAGCCGGTC GAAACCGGGA AAGTGATCGC GATCCAGGCC GCGAACGGCC AGCACGTCAA     27420
     GCAGGGGGAG ATCCTGGTGG CCCTCGATCC CGAGGATGCT CAGGCGGAAA CCGTGGCGCT     27480
     CACCATGAGC CTTGCCTCCT TCAAGGCTGA AATCCTGCGC CGCAAGGCGG CCCTCGAGGC     27540
     AACGAAAGAG CACCTGCTCA GACCGCTGCC GCTCGTCCGG TGGGAGGAGG AGATCCCGCG     27600
     TCCCATCCAG GAACGCGAGG AGCGGGTGCT GCGGGGCGAC CTCGCCCTGT TCGCCGCACA     27660
     GATCGAGGGC CTCGTTGCCC AGCGCCGGCA AAAGGAGGCC GAACAGGAGC GGCTCACCAA     27720
     GACCATCGCC GCCCAGGAGG CTCTCCTGGC GACGCTGGAC CAGCGCGTTG CCATGCGGGA     27780
     GGCCCTGGTC CAGCACAGCG CCGGCACGCG GGCGAACCTT CTCGATGCGA TCGAATCCCG     27840
     CCAGTACCAG GACGTCATCC TCAAGACGCA GCAAGGGCAG AAGGCCGAGA ACGTGGCAAG     27900
     CCTCGCGGTT CTGATCCAGG ACATCGCCAA GAGTTACGAG ACGTTCACCG CCGAAAACAG     27960
     CCAGAAGCTC GCGGATGCGG AACGCCAGGC CGATGAGAAC GCGCAAAGGC TCGTCAAGGC     28020
     CCGTGTCAAG CTCGGCCATA TGCTGCTCAC GAGCCCGATC GACGGCACGG TGCAGGCGCT     28080
     CAGCGTGACG ACGCCAGGCC AGGTGATCGC CAGCGGCGAG GAGATCATGC GGATCGTGCC     28140
     GGACGCCCCG GTCCTTGAAA TCGAATGCTA TCTTCAGAAC AAGGACAGCG GCTTCGTCAG     28200
     GCCGGGCCAG GAAGCCGTCG TGAAGGTGGA ATCCTTCCCG TTCACGCGGT TTGGCACCCT     28260
     GGGGGCGGAT GTCGTGCGGG TCGCGCAGGA TGCGATCCCC GAACCCGATG CGCAGCTGAT     28320
     TGAAGGCAAC CCCGCCAAAT CGAACCGATC GACCGTGTTC GCGGGGGCGC AGCGGGTCCA     28380
     GAATCTGGTG TTTCCCGTGA CGCTCAGACT GGCCGCTTCG ACGATGATCA TCGAGGGGAC     28440
     CCCGGTTCCC CTCTCCCCGG GCATGGCCGT CAGCGTCGAG ATCAAGACCG GCAGCCGCCG     28500
     CGTCATCGAC TATCTGTTCT CCCCGCTCGT CGAAGTGGTT ACAAGCGCTA TGCGGGAACG     28560
     ATAACAGCGT TCATGGGGCT ACACACAAAG GCGGTGCTGT TTCTCCGGTC TCCCGTGCTT     28620
     TCCATTGGAC AGCCGGTCTA ATAGTCCGTC AGCCGACTGC CCGGTTCGAG CTGCCCTTTT     28680
     ATCGTGAGGA CGTCTTTCAG GATCTTTCCC TGCTCGGGCG TCAAGCCGAT AAAGAAGCGA     28740
     AGATCATCTT CATTGGCTTC GTTATTCTTC AACTGTTCTT CCAAAGACGG TTCAAAGGGG     28800
     CCTTCTTGCT CACGGACGAA GGTTGGATCG TCTTTCAGAT CGTAGCGGCC AGACTTGCGG     28860
     ATCGAGGGCA GGACCGTGCT CGTGACCCAA TCCTGAAAAT CTTGGCGCCC TCCGTTCGCG     28920
     CCGTCATGAT AAGTTTGTAA AGGCCGGATT CCGAGATCAC GAGCCCGGCT TGGGGACCGC     28980
     CAGGGGTGTG GTATGTAGCG ACATCCTTTT CTATTTCATA AAGCTTTTCA GTTGCTTCCG     29040
     TAGGTTTTGT ATGGCTTAGG GCGGCGCAGG CATCGCTCGC AATAAACCAA GGCTCGCTAT     29100
     TTTTGAGAAA TGTCCGGATC AGAGCGTCCT TGAAATAGAA GTCTTGCGTT TCGATCGGCT     29160
     GCTCTTCGAG TTTCGGTTTT TGCGGCGCTT CATTCATATT CATAACATCC TGATTTATGA     29220
     CCGGTAATTT CTGCACGGCA TGGCGTTGAG CCTCCCAAGG CTCCGCCAGT CAGGCGCAGA     29280
     TCAGGACATC ATCCATCCAT GAATAGAAGA AACGGCGCGG TTTCGCGGCC TCTCTACTGC     29340
     TCGCCCTATA CATGTGTATT TTCACTATGC GCCTTATGCG CGCTCGATCG GCGTGAGCGC     29400
     CCAGCCTGCC CGGAGGGCAG GCCCCGCACC AGAGGTGCAT TGGTGTGTAC CTAATTCTTC     29460
     TCGTTTTTTA TGGCAGTAAA ATAGCAGTGA GACGGCAGTC AAACAGCCGC GTAGCGGAAG     29520
     TGAGATGGTC GTGAGACGGC AGTGAAAAAC GGCCGATAAA AAAGTTTTCG TTTTTATCGT     29580
     GAGCCGGTTC GACGTTTTGC ACATGAGCAA AGCAAACACG GCCCAATTTT TTGAAAGCGT     29640
     CAAAGCGCAT GGATTTGTCC GCCGGTCAGC GGTCTATCGC TGGATGTGGA CGAATTACGA     29700
     TGACTTGAGC GAGCTTCTTA AAGAGGCTCG GCCGAGTTGG ATTGTGATCG CACGTGAGTT     29760
     GAATGGAATT GGGCTGAGAG ATGCTCGAGG CCGGGATTTG GCGTCGGATA ATATTCGACG     29820
     TGTTTGGCTG AGGGTCAGCC GTGATCTTGA AAAGGAACGG CAAGCGGCGC GCGCGCAACA     29880
     GCGCCCCGCC GAGCCGGCCA CGTCAGCGCG GGAAGAACCC AAGCGCTTCA ATCCGTCCAG     29940
     GCTGCCAGCC AATTACCGGC CTGATGTCGA AATCAAGCCT CAGCCATCCG TGCCAGCAAC     30000
     GTCAGGTCCT TATCAGGTTC CTGCCTCGAT CGATGTTTCC GAGGTTCCGG AATTTTACAC     30060
     CCGAAAGGAC GGCACGGTAG TCCATCGTAC TCAGGAACAG AGGGAGAGAA TAGCGCAACA     30120
     ACGAGCAGGG TTTGAAAAGG AAACACGCCA TATTGATCGT TATATACTAA CACAAAAAGC     30180
     AAAGTAATGG AGAATAAATA ATGTCATTGT CTCTTGAACA CATCAATGAT CGGAACCCGG     30240
     TCTTGTTTAT TGCCATTGGG CGACAGCAAG CTGGGAAAAC GACCTTTCTG AATACGACCG     30300
     CGCAATACTT GAAAGAAAGG GGTGGGACGT TTCAGATCTG GAACGCGGAT CTTCTGAACA     30360
     AAACGCATGG TCTCAAGCTC TTTCATGATG AGACGATTGA GGCCCCCTCA TTGACGAGGG     30420
     ACGATGTCAA AGCCTGGCTT CAAGGAAAGA TCAAGGAACA GGCCAGGGAA CGGTTCGATG     30480
     CGGTCCTCGA CTTTGGTTGC GGCGATAAAC CTTTAGAGTC CCTGATCGAG GCTGTGCCGG     30540
     AGATAGCGAC TCTTCAGCAA CAAGGTATTC GCGTGGTTGT GGCTCATCTC ATTGGGCCAC     30600
     GTTTGCATGA TGCCAAATAT CTCGACGGCT TTAGCCAGCC CAGCACGTTG ACGCCTGATG     30660
     GCACGCTGAT CGTCTGCAAT GGGGGCGTGG TCCCAGAAAA TCGCGACGAA AAATTGGCGT     30720
     TTCAAGAAAT CATGCGCCAC GGCGCGATCG AGGCGGCCTT ATCGAAGGGT GCCCTCGTGC     30780
     AACTCTTTCC GCGATTTTCG CTCATGCTGG ACGTCACTGA ACGGGAACTG ACGTTCAACG     30840
     AGGCCATGAA TGGTGTCGAG GGGCAGGATG GCCGTGCCTT TGGTCTCGTT GATCGAGCGC     30900
     GTGTCGAGAA ATGGTGGATC CACCTTGTTC CAGATTTTTT CCAAGAGGTT CCCACTGAAT     30960
     GGCTACCTTC CGTTCAGCGG AACTGAATGC GGTCGTCATC CACAACCCTG CAGGTTTGTT     31020
     CCGGACAACA CGTCGAACCG GACAGAAGAA TTCATGGAGC AGATTTATGG TGCAGTCTTA     31080
     CGAACAGAAT GGTGAGCGCA AGCCGGTTTT GCTGATTGCC CTTGGACGGC AGAGGGTCGG     31140
     CAAAACGGTC TTTTTGAATA CACTAGCCCA ATATCTCAAG CAGAAAGGTG CACGGTTTGA     31200
     GATATTGAAT GCTGATCTTT TGAATAAAAC TCACACGCTT ACACTCTTCC ACAAAGATAC     31260
     GGTCGAGGCG CCTTCCACAC ATCGTGAAGA CATGCAGGCG TGGCTGGTCG CCCAATTCAG     31320
     GAGGCAGATG GATGAGCGTT TTGATGCGAT CCTTGATGTT GGCGGTGGAG ACACGCCATT     31380
     GGAACGGTTG ATCGAAGAAT ACCCGATCGT CTCCGTGCTT CAGGATCATG GCATTCGCCT     31440
     GGTGATCGCT CAGGTTATTG GGCCGGACAT GGCTGATGTC GATTATCTCG AACGGTTCAC     31500
     GGAGCGCAGT ACCTTGATGC CAGACGGGAT GTTGATCGTG TTCAATGGGG GTTTGGTCTT     31560
     GACAGGCCGT TCGGCCAATG TTGCGTTCTC TGAAGTTGCA AAACATCAGG CAATCGATAC     31620
     GGCGGTGGAT CAAGGTGCAA TTATAAAAGT CTTTCCTCGG CTGCCATGCA TGCAGGAAGT     31680
     CACTGATCGG CATTTGACGT TCCTCGAAGT GATGAATGGG GAGAAAGGGA GGGGGAGCCA     31740
     GGCTTTCTGT CCTTTTGACC AGGCGCGGGT CAATCGCTGG TGGACGGTTG AAGTGCCGGA     31800
     ATTTTTTGGA GGCGTTCCCT CCGAATGGCT TCCCGCCATT CCGGAGAATG GGGCGGCTCC     31860
     GATGCCTGCG GTCGTGGGGA ACGAACCGAA GGCCTCCAAG AAAGAGCGAA AGGACGCACA     31920
     GAAGCTTGCC GAAGTCGATT CCTCGGAGTC GCTTAATGGC TAAGACAGAA GAGCAAGCCT     31980
     CGCTTGTTCA TCAGCGCGTT CTTCGATTGT CAGAAGAGTT GGATCAAGAC CTGGCCGCTA     32040
     TTCAAGCGGC CGGGCGTGAA TGGGGCTTGC GCCATGATCA TCCCGAAGGG GCGTTTGTGA     32100
     CGGCCATGAT GCATGCAATC AAGCGGACGG GCGAGCTGAC TGTCGCGGCG GCGAACGATC     32160
     TGAATACCGT GGCGGAGACC TCTCGCAAGA CGGCGCAAGT CGAATTGCAG CGTCTCGGGC     32220
     TCGCCAATGA TCAAGCGCTT CTTCTCGTCG AGCATGCACG GATCGAGCGC GTGAATTTCT     32280
     CGCAGGATCG GGACGCGCAA GTCGCCAAGA TGGTGGCGAA GCTGGGCGAA GACCTGGTGA     32340
     CGGGTGTCCG CGACTGGACC GTCATGCGTG AAAGGGAATT GAATCGCAAA TGGGCCTTTA     32400
     ATCGTGCGGT CATTGCGTCG CTGATCGCCG TTTCGATTTT TGTCGGCGGC TATGGAGCGC     32460
     GGATCTATCA GGAGAAAGGA GTTGGAATGA ATGGGGAGCC GTGCAAGGCG TCCTCATTGT     32520
     ACCGGGCGGC GAACGGAGAG ATTTGGTGCA AGGTTTCCGG CACGGCGCAA TAGGTGCTGT     32580
     CTGCATTGAT CGAGATTGGG CAAAAAAGAG CGTCATTGGA TAAGAGGTTC GTTTTTTTCA     32640
     TGAGCAGCAA AGAGCATCGG GCTGTCCTTT CACGACGGAG GTCCGATGTT TTGCGATTTC     32700
     GAAGATCCAG GGAGCCTGGA AAGATCAAAG GTCCGGAGGA CATTGATTTT TATCATTGAG     32760
     GTTTCGCTGA TGGCGCTGGC GATCGGCAGT GTTGTCGGCT TGACCAAAAG TTACGCGGAT     32820
     CCGGCTCTTG CGACCCAGAA TGGGTTGCCG CAAGTGCCCC GGGAATATGT GCCGGAAATA     32880
     GGCGCTCCCG CGATGGTCTA TCCGACATCG CCAACGTCCT CGGATGCCAG CTCGACTGGT     32940
     AATTCCAGTA GCGCTGGCAA TTCTAATGGT ACGGGAGGAA GCAGCGGAAC AAATTGGAAT     33000
     TATCCCGGAA CTGGTTCGGG CGTATCAGGT GCGACCGTTG CTCAAAACTA TTCGAGCTAT     33060
     AACGGTCAGA GTGTTGGCAG TGGTGAATGT GTGGCACTCG TGCAGGCAAC GTCAAACGTT     33120
     GGCTTGACAT CAACGTGGTC GCCAGGCGTT CAGGTTCAGG GCAATACCGA TATTGCGGCA     33180
     GGAACAGTGA TCGCGACTTT TGGTAGTAAC GGAACTTATA CTAATACCTA TGGTCAGTCA     33240
     CATGCAGCCA TCTATCTCGG ACAGAATTCA AGTGGAATTC AAGTCATGGA TCAATGGCTT     33300
     GGACAGGCTG CCCAAACCCG TACAATCCCT TGGACCACAC AAAACTCATA TGAATCCGGG     33360
     AGTCAGTTCT ATGTTGTTTC GCATTAAAGC TTTGCTGTTG TTGCAAGCGC TATTCTTTTC     33420
     GCAAACTGCT CTTGCTGGAA GTCTGTGTCA GACTGGGTTG AAAGGTATTA CGCTGACTGC     33480
     TGGAACATAC GATCCCCCAG GCATTCTTGC ACCGGACAGT CAATTATTAA AGCCTATTGG     33540
     TCAATGGCCT GAAAATCTCA TTGAGCAAGG CTGGCATAAT CTGAGGAAAG CGCCTCGTCC     33600
     ATTAGTTTTT ACTTGCCGGT ATAAGGATGG AAGGGAGGAG ACAATCCTGC TTTCTGAAAA     33660
     AGTGGATGCC TGTTTCTTAA GGGCAGGCTT GAGTTTCAAC TGCGAATAGC GCGAGGATCG     33720
     AAGAGATCAC GCAATAGAGG TTTTGTTCTT ATCATGAGAG GCAAGGAGCA TCGGATCGTC     33780
     CTTTGACGAA GGAGGTCCGA TGTTTTGCTT TATCGAAGAT GTAGAGAGTC CGGACAGATC     33840
     AAGTGGCCGT AGGCCATTGA TTTTTCACTT AGAGGTGTCG CTGATGGCGG TGGGGATGGC     33900
     CGTGGTTGGA ATGCCCAAAA GTCATGCGGC GCCAGGGCTA GCGACGCAGA ATGGCCTGCC     33960
     GGAAGTGCCA CACGAATATG TGCCGGAAAT AGGTGCTCCC GCCTTTGTTT ATGACACTGG     34020
     TCCGGCCAAT GGAAACCCCA GCACGCCTGT CAATTCTAGC ACTGACAATT CTTCCTACTC     34080
     CTCTTTGACG GGAAGCACGA ACGGCGGTTC CGACAATGGC GGGGCCTCTC TTGATACAAT     34140
     GCTTTCGAAG AGCTGGGGGA CTGCCGCGCA AGCCGTGGCA CAGGCAATGG GTATCAATCC     34200
     CTCGGCCCTG GCGGCGACTT GCATGATGGA AAGCGGTTGC TCGAATGCAG GAGCGGCAAG     34260
     CGGAAGTTCC GCGTCAGGCG CTTTCCAGAT GATCAATTCG ACTTATACAG CGGATATCAA     34320
     TCAGGCTGTG GCGTCCGGTT TGGTGTCGAA TTACAACGTC GATACAAGCC TTGCAGGAAA     34380
     GATGGATCCT GCGAACGAAG CGATCGCCGC GTCGCAAGAT CTGAAAAATG CGGCTACAAG     34440
     ATTGCAAAGT ATGGGTATTT CCAACCCAAC TGTCCTTGAT ACCAGAGCAG TTTATCAATT     34500
     TGGCGCGGGC ATTGGACCGT CTGTCGCCAA GGCAGATGCT TCTGCGAATT TAAACGACAT     34560
     TGTTGGGTTA ACGGCTCAAC AACTTCAAAA TAATGGTTTG ACCGCTACAA CCACAGTAGG     34620
     GCAGTGGCGA GCAACTGTCG CACAGAAGCT TGGAAACACG GCAAATCAGG TCGTTCTAGC     34680
     GAGTCAATAA TGGAGTGTAT ACAAATGTAT AAGGCAACCT TTTGCTTTAT TTCAATAGCC     34740
     TTCATTTCAA CGATAGTTAG CAATGCGATT GCTCTTACAG CAGTCAAGCC AGTGACTGAG     34800
     CTTAAATGCA TGCTGCTAAA CTTGCCAGAT GAAGTTATCA GGGCTTATGA GGGGCTACCG     34860
     TCAGAATATG CTGAAGCTAA AGAGAATTCA AAGGAAATAG GGAAAGCGGA GAAATTTGTA     34920
     TTTGTGTATA GAACACAAAC GGAAACGAAT GGGTTTCTCA AAGTTGTACG TTCAGATTGG     34980
     ACTCAAGGGT GGATTAAGGT TGATCTCTTA AAAGAATATC AAGCTCCGTC ACCTCGATCG     35040
     AAACACTGTA TCCCATCTAA AATGTCTGAT GGATCTCTTG GATTCCGGCT TGATCCGTGA     35100
     TCTATTCCAA TGATGTATGC GTTTCATTAT CATTGACAAT AAATTCCATA CTCTGGCGGT     35160
     GTACATACAG ACATTGCCAG CAGTTTACAG ATTTGCTTGC ATACAAGCGG AATAGGATAT     35220
     ACTAATAGGG ATATTCGGAT ATTTAAAAAG AATATCCTAT GCCGTTATTC ATCAAGGACG     35280
     CCTCCGTTGA CGAACTAGCA GCGGAACTTG CCCATTTGCT GAGTGTGAAT AAAACCGAAG     35340
     CGGTACGCCT CGCCTTGCGC CAGGCGCTGG ACAGAGAGAA GGCCACGGAA TCTTTGGCGG     35400
     AACAGGCCGT TCGCTTTTGC CGCGATCTGC GGGCACGAAG CCATCCGGAA AGAGGCCAGC     35460
     CTGCTGATAA GGCCTTCTTT GATGAGCTGA ATGGTGGGCT TTGATGTTCG TGGATGCTTC     35520
     TGCTCTTGTG GCCATGCTGA CCAACGAAGA TGATGCGGCT GATCTTGCCC AACGCCTGTC     35580
     TCAAACGTCC AAACGCTTGA CGACACCAAT CGCGATCTTC GAGACCGCTG CGGCAGTCGC     35640
     TCGGGTCCTG GACCTGCCGT TTGATGAGGC GCGGGAGGCT GTTGAAACTT TCCTCCAGCT     35700
     TCTCAATGTC CAAGTGCTGG CCTTGCCGCC GAGGGCCAGT ACGCTGGCTC TCGAGGCCTT     35760
     TGAGCGCTAC GGCAAAGGGC GTGGCCATCC TGCACAATTG AATATGGGTG CATGTTTCTC     35820
     TTACGCCTGC GCACGCTATT ATCGCATGCC GCTTTTGTAT AAATGCGATG ATCTCCGGCA     35880
     GACGGATATA GAACGAGGTT GAGCTAGCCA AGGCTTTGCC GATAGTCTAG ATGATCGCCA     35940
     TTCTGGCGCC TGGTTTTTCC TCGACAGTGG CCGAAGCCGA GCCGCAGCGC ATTGGTCCTG     36000
     CGCACAAGAG GAGAAGCCCG TCATGTCGAG ACTAGCAATC GCGTTTGTGT TGGCACTAAC     36060
     CGCGACAGCG GCCAACTCGC AAGATACTAA GTCTGGACAA TCGTTCACGC CGTCCGTTCC     36120
     CAGAGAGAAT GGAGCACGGC CATTTCTATT TGATGGACGA ATGCGTGGTG ATGGCGTCCG     36180
     GCAGGGAGCA CTCGCCGACG ATCATCATCG CAACGCAGGC GCTATCGTCG TGCAGCCGAC     36240
     AGTAAGCCAG CCCGGGCGTG AATGATGAGT ACGCGCCTCC GTTTTATAAG ACTGGGAAAA     36300
     TGCCCATCCT TAGTCCTGTT TATCAGTACC GATCATAGTC ATGCCGCCCA TCATTCGATA     36360
     ATACCTTGAA TATTAGAATG ATGATCTTGA AGACGCCTTT TATGACAAAG AAATAGAAAA     36420
     GAAATGCTAT GACAAATAGA ACAATGAGAG CGATGAATGG CATGTCAGAC ATGATGAGCA     36480
     TATTGGTTTC CATGACGTAA TTCCTAGAAT GATCTATTTT ATTGATCTGG TTTGTTATGA     36540
     AAAGCGCCCC ATGCGATGAC AGGGCGCTAA TGTGTTTCAG TAGTTATTGG GGCGGCTCCA     36600
     GATGAGTTGG AAGTCGGGTT CTCCCTCGAC CTCGACGAGA TTGCCAAAGA TGGGGGCGGG     36660
     AAAGCTCGGA TCATCGAGCT TCAAGGCGAG ATAGGCTTCG CCGTTATCCT TGGTGAACTT     36720
     TTCCCAGGCC GCGCCGATCT CGGCACCGTT GCGAGAGGAA CGCACCCGAT AGAGCGGGGC     36780
     CTCCTCGGAA AGTCGCTTAT CATTGAGAAC GAGTTGGGCC TGGACATTGA CCGTCAGGGT     36840
     CCGAATGCGG CCTTTATAGA TCTTGGTGGA AGCGTCGTAA GAGAAAGAAC CGATGACTGA     36900
     CATGGGGAAG CTCCTGCGAG TTTGAGATTT GCCCTTTAAT ATTCGGGGGC CGGCCGTGCC     36960
     GTGCCCCCTT GCCAGGTGGC GAACCGGGGG GAGGGGAAGG GGCAAGCCTT TTCTGGGGAG     37020
     GGGTATCACC CACCCTTGGG CGGCGCCCGC GGCGCCGGTT TTTTCGAGCG GAGGAATGAA     37080
     GGAGCGCGCG CAGCGCCTTC CTTGCGCTCG GGAAAATTGG GGAGACCCCA GAAGGGGCTT     37140
     GCGGGAAGGG GAGGAAGGAA CGTCTTCCCC TTCCCAAACC GGCCATCGCT TGCGATGGCG     37200
     CGAGGAGGAG AGGACGATCA CAAAGGTGAT TGTGCCGAAG GAATGTCAGC GCGTAGGCGC     37260
     TGCCCGACAA GAAGAGGGCT GGATCAGCCA CAGGGGATAG GGAGGCTGGC GCGTGAGGCC     37320
     GGGGCTTTCG TGCGGCGAGG CGCTTTTGCG GGGAGGAACC CGGCCTGTCT CGGCCGGCCG     37380
     CGACAGGGAT CGTTACCTGA AAGGCGAAGA CGGTGCGGAG CGCTGGCTTC GGGCGAAGCC     37440
     TAGAGCCCGG TCTTGCAAAG CAAGAGTCGC CCGAGCGCAT TCATTCAGGA AGGACTGGGT     37500
     GCAGCAGAAA TTTGTTTCAG CGAATTGTGA GCCCGAAACG ATCGCAGGCG ACTGATGAGG     37560
     GATAGAGATC GATTAAGAAA AGGCTGTTAT TTTATTGGAT GGATGAAGGT CAATATCTGC     37620
     AATCTTTTGC GAAGACGCAT TGGAATATTT GTGACTTCGG AGCAATATCT TGAATAGACG     37680
     ATATAATTGA TTGCAATGAA AGGGATTAAT GCGATCAAGA AACCAAATGC GATGATTATG     37740
     AGCCCGATGA TTACGAACGA AATGAAAAAG AATTGGCTGA GTTTAAAAAT CCTTTCGAGA     37800
     TGAAGAGGAT GGTTCTGATC ATAGATGACT TCATTATGAA GTTTTTTGAT GAGGCGCGTT     37860
     TCCAGAGGAT CTATATCGTC GCTTCCATAG ACGAGACTAT CAACGATGGT TTTGCGGTGA     37920
     TGGAGGTAGC GCCGATAAAG GAATTCATCA AAGGAGAGTG TAAAAACGCT CAGTGCGATG     37980
     AGATAGATCG TTTGAAGCGT ATTCATTGAC GGACTGCCTT GTTGAAGGTG TTGATCAGGA     38040
     TGCAGCCCGA GTGTGTTGAT GATTCATGAG AATAGGAAAT CGCGTTTGGC GCGGATTAGG     38100
     CGATCATGGC GGAAAGGTCG TCCTGCCGGG GTTTATTCCG GCAGAAGGAG CCCTTGCCCT     38160
     TTCTGGGGGT GATGACTTTC GGGCGTGTGT CGCTGGTGAC AGCGACATGG GCGCTGGCGG     38220
     CGCGCAAGCG CATGGCCTGC GTGGCACGAT TGCGTGGGGC ACGGATCGTT TTTTTCTTCA     38280
     TGGCTTGATC TCCATAGCTG TATAGCTGGC CTTGCCTCCC GGGCATGAAC GTAAGAAAGC     38340
     GCCTCGCATG ACTGCGAGGC GCTTTGGATT GGGTCAGTCC CTTCTGGGGC GGCTCCAGAG     38400
     GAGTTGCAGC TCGCGCTCGC CTTCGACCTC CACCAGGGAG GCGTAGATCG TGCTCGTGAA     38460
     GCTTGGATCA TCCAGCTGGA CCGACAGGTA TTCGTTGCCC ATGTCCGACG TCTTCATCCA     38520
     GGCGGCACCG AGTTCGACGC CTTTCGGTGT CACGATGCGG TAGTGAGGGG CATTGTCGTT     38580
     GGTCCGCATC GGGATGGGAA CCAAGGTTGC ACGCGTTTGG ATGGTAAGCG TGTTGATCCG     38640
     ACCGACAAGG GTGTTGTCCT GGGTGCGGGT GAAAGAGCCA ATCGTCGCCA TATCCGTTTT     38700
     TCCTCTATTC TGAGGCCTTG CGTCCATCGC CGCCTCGATG GCGATCAACA AGACCGGGCC     38760
     GAGATCGTCT TGAACCTGAC CGGGCACCAG GCCTTGGCCT GGTCGAGTCA GGCCGGAGCA     38820
     CAGCGGAGGA TTGCAGAGCG GCAATCCAAC CGGGCGCCAG ACGCTTGCGG CTGGCCGAGT     38880
     TGGGCTTGCT TTCTTGTTCC GCGAGGAGGC CGCAGGCCGG GGAAGAAAGT TGCGCGGCGC     38940
     TATTGTTGAC GAGATTGGTT TGGTCTGATC TGGCCATCTT AAGAGGCGCG GGGACTGCTT     39000
     GGCCTTTCAG GACAGGGAAA GAGCGGATGG CTGACCGATG GCTTGACCGG CTCCCGAAAA     39060
     CCCTGGGGAT CGACGCACCA TGGCAAAGAA CGCCCAAGCC TTGATGCCCT GAGCGGACAA     39120
     CGTCCGGCTT CCTTCCATGC GTCGATGACC CAAGCAGAGA ATAGGGCCTT TGCCTTGTCT     39180
     CAAGAACGAG GCAGGCAAGC TCAATCCATC AGGCTCTGTG GCCTTGATCC AGCAACGAGA     39240
     CGGATCAGCC AGCCGGTGGC CGGGGTCGGG CGCGCGGCGT TGCTTCTCCC TGCCGCCGAG     39300
     GGATCGCACC GAGCAAGCGC GTATCCATGC GGGGTGCTTT AGCTGGTGTT CACAGCTGAC     39360
     CGCGACAGGG ATCGTTACCG AAGGCGAAGA CGGCGTGGAG CTTGCGGAGC GCTGGCTTCG     39420
     GGCGCAGCCT AGAGCCCGGT CTTGCAAAGC AAGAGTCGCC ATGGATTGAT AATCAATGCA     39480
     AGAGCGAGCT GGTTACGTGA AACATTTCGG CTTGAGTTCG CTTCTGGCAA TTATTTTATT     39540
     GTTATTACGA TGCTGTATAA GCTTGTATGA AGAGATACTG ATCATTGGAA TGAGGGATAA     39600
     TAGTACCGGG AACGGGTTGT CAGGGGATGA ATTAAAAACT GCGATAAAAG GAAGAATTTC     39660
     TACTAAGATT GCGATGCATG TGACCGCAAC GAAGATTAGT GGCTCACTCA AAATAGATAT     39720
     TTTCATCTTA TGTAAACCTC CTGCGAAGTT TTCATTGAAA TCATTTGTCT TATCAAGACG     39780
     ATTGAGAAAT TTCCTTACTG GTTTCGTCTT CGATGTCGAA ATTCAATCCT TCGTAGAGTT     39840
     CAGCAAGAGG CAACTCGATG CCGATTTCTG GCATCTGGAG GATGGCATCG TCCGAGAGAA     39900
     TTTCGAATGT CCAGGTATCG CCGGCACGGG CATAAATGGT AGCGCCGATG CGGTCCTGTT     39960
     CAAGCATGAT GTAGCGCTGG ATGGAGGGTG TGGCCTGATA TTCACGGGCC TTGACGATAC     40020
     GATCGGTGCT TGCGGTTGAG GAACTAAGGA CTTCGAAGAC GATGACGGGA TCAGCGATAG     40080
     TGGTGCGTCT ATTCTGGACG GGAGAACAGA CGATCATTCC GTCGGGATAG CGGGAGGAAT     40140
     TGTCGGCGAC GAGGGCCTTG AGATCGCTGC CGATGAAACG GCAGGGTTTG CCACGAAGAC     40200
     GACCCCCGAC AGCTATAGCA AGGTTGGTCT GAATGATGGC ATGAGCTTCT GTGCCCCCAG     40260
     CCATGGCAAA GGGGGCAGAG CCATCGAATT CGTATCGGAT GGGCTGCTGT TCTTCCCAAG     40320
     CGAGGAATTC GGGCAGGGTC ATGGGCTTGC GGAGAGGCAG GTTCATGATG GTTATCCTAT     40380
     CACAACGGCA GGCAAAAGGC TTGAACAAAG AGGCTGGGGT CATCCCCAGC CGATATGGGT     40440
     GGCGCCGGCT TCACGGCTTT CGTTGAGGAA ATCGGAGAGA TCTTCGAGGC GGCGCTCGAT     40500
     GTAGCCTTCG GATCGTCCGC AATCGATGAC CATGGCGTGG CCAGGCTCCT GGTGTGCCGT     40560
     CGTTGGGATT TCTGGCGAGC GATAGTCGAG GCGTTTACGC CTTGCGACGG TGACGAGAGC     40620
     GCGGAAGGCT TCGATCGGCC AAGGTGCGGA GGAACAGGAA TCCTCGATAC CGAGGGTATT     40680
     GAGGAGATCG GTGCCGTTGG CGCTAGATAG ACAGAGTTCG ATATCGTCGG GCAAATCGAC     40740
     GAAGTGAAAT GCATTGTCTT TTTGATGAAA GGCATTGAAT GAAATGGACA TAAGATTGGT     40800
     CTCCGTGGAA TGATTGTTCG AATACGAGGC TGGGAAGATA CCCAGCCTCG GGGATGTGTG     40860
     TCAGTACCGG CCATAGTCAC GGCGCCTATC ATTCGATAAT GCCTTGACTA TAGAACCGAT     40920
     GATTTTGAAG ATGCCTATTA AGACCATGAA ATAGAAAAGG AAAAAGAGGA CAAAGATAAC     40980
     AATGAGAGCG ATGAATGGCG AATCGAGCAT GATGAGGATG TTGGCGTCCA TTGTGTAAAT     41040
     CCTGTGATGT TTGGCAGGGT TTGAACTCAA TTGTCAGGAG AGGCGGGAGC TTTCGCTCCC     41100
     GCCTTTGGAT GTCAGCGGCG CTGGAAGGCA TCCATTTGCG CCTGGGTCGA GCGGTGTTCG     41160
     ACGCGTTGTG TGGCCTCGGC GCGGGGAGCG TAGGGCTTCC AGTCCTGGCC GGTGATGTGG     41220
     CGGTAGGCAT CGACGGCGCC ATGAGCGGCC GCCATCAGGG CGTAGGCCTG GGAGGCCATT     41280
     TCAGCGGCGA ATTGCCGGGC ACGTTCCTGC TTGTTCTCGA AACCTGCCAC GCCGTCGCGA     41340
     TCTTCGTCTC GGTCATCGTT CCCAAAGCCG CTGCTGAGCC GGGCGGCCTC GGTAGCCTTG     41400
     TTGCTGTAGA AATTGGCGGC ACCCCAGGCG GATGCGACAT AGGCGCCGGT GATGCGCTCG     41460
     AGGTGCATTT GCAAAGCCTT TTCGCTGAGA ACCTTGCAGA GGGCGTCGTT CTCACCCATC     41520
     AGATTGAGCT GCACCGTGTC GCGGATCTTC TCATAATCGA CGTCTTCAAG AGCGAAAGCG     41580
     GCTGCGATCT TCACCATCAT CGAATGCGTG GGGGCGACCT GCTGCACCAT CTCGAAAGTG     41640
     GTGGGCTTGC GCTTCTTTTC GGGCTTTTGT CCGAGAGTGG CGTTTGCGTC GTCGATGCTC     41700
     TTGAAGGCCA TGATCTTGTC TCCTGTCACT GCTGTTTCGA GGCCGCGTTC CTCAGCGCCT     41760
     CGATGGCGAT CGAAGAGACA GGGGCGGGTT CGCCTTGCAC CCGACCGGGG ACCGGCCGCA     41820
     GGCGGGTCGA GTCGGGCCGG AGCGTAGCGG AGGATGGCAG AGCGCAACTC AACCGGGTGC     41880
     CAGCCGTTTA CGGCTGGCCG AGTTGGGCTG GCTTTCTTGT TCCGCGAGGA GGCCGTTTAC     41940
     GGCCGGGGAA GAAAGTTGCG CGCCGCCATT GCCAGGCGGT TCCGCTTCTG TCTGATCTGC     42000
     CATCTTTGAG AGGCGCGAGA ACGGCGGCCG GGAACGCCAG AGATGACAGG TTGATCGTGG     42060
     AGCGCGCTTT GAGAGCGCCG GCAACCGCCT TCGGATCGAG CCCTGAAAGC GCGAGCTCTT     42120
     TCAGATCCGT GCGTGAGCTA CCTTCATCCA AGCCGGGAAA AAGCGTGCAA CAGCCTTTTG     42180
     AAGACGAAGG GAAGCCCCCG TCACGAGCTC AGCTCCGAGA GAGAAGGGGA ACCGCCTGGC     42240
     TTCTCGGAAA GGCTGATACT TCTCGGCGGG CGCCCAGCCG CTTCCGTCCC GCCTGCCCTT     42300
     ACAGCAGAGA AACAGGGCCT GCCGTCCGCT CCAAGAGACT TTGCCGATGA GTGATGGATC     42360
     CATCGGGGTG GGGCATCGAG AACAAGCGAG CACTGCAAAG CGCTGAAAGG CCGTCGCAGC     42420
     CCGGCCTTTG ACGCTCATGC GCAAGAGATA CAGTGTCCGG GCTCGAGACT GGATGCTCTT     42480
     CCGACAAAAC GAGAGACAGC ACGCGCATGC CTGCACATGC CCGCGCATGC ATGCCATTCT     42540
     CAACGCTCAT GCTGAAAGGC GGGAAGAAAG CCCGTCCTGT GATGATGGGA AGCTGTGCCA     42600
     CAATTCACGC GGCGCATGAA ATACTATAAT AATCAACATG TTATGCTTGC ATATCTGAGG     42660
     CGCTTCGGTT ATGGTAAGGC TATCGCTGAA GGATGGAGGC TGCGATGCGC GTCGAATATT     42720
     TGCCCGGCAC TGACAATGTC ATCCGGTTTC CAGTCGAAAG GGATGAACGG CCAGGCCTGG     42780
     CGCTGTTACG CGAAATCGCA CCGGATCCGC GCGAGGTTTT CTATGCAGCC GAAGCCTTCA     42840
     AGATCGCGCC GCCTCTTCAT GGCCTTCGCG GTGAAATGGA TCGGGAGACG GCCGACTACA     42900
     TTCTGAATCA AGTGGATGAT CAGCCTGGAC CACGCCGACA GCGAGAGCTC GATGGTCTCC     42960
     TGGCGCCTCT GGTCGCCAAA GCCGTCAAAC TGTGCCAGGC CCATGATAGG ACGAGCGAGG     43020
     AAATCGATCA GGCCTATGAC CATTACGACA AAGCGCGGGG CAAGAACGAT CAGGCCAGTC     43080
     AGCTTTGGAT GAATGTCTTT GAAGCCAAGA TCGTGGCCGC GACGCATTTG CTGATCGAAG     43140
     CCTATGAAGC TTCCGAACGT GCGGAGGGCG CGGCGCGGGC GGTGGCCTAT GCCATGCGTG     43200
     GTGAGCCTTG GGAGCCTTTC GATGTTCACA AGGCCATGGA AAAATTGTGC TCTCTTCACA     43260
     TTGAGTCCAA ACTCGGCCAG TAAGGCTGGC AAGTGGACCC TGGCTTTATG AGAAAGCCGC     43320
     GGCGCTGATG TTTCAGCCCG TGGCTTTCGT TTCGGGCGGC ATCTTCCCCT CGGCGGTGCA     43380
     TTGCTTCTTT TCGGGAGAAG CATCTTTTTC GAATTCAGCC ATGCAATCTT CGAGAAATTG     43440
     CGTGGTCGAA TGGCATTTGA TTTCATCAGC GGTGATGAAG CTCGCCATGC CGCCAAATCC     43500
     ATCGGAGCGC ATTTTGGAAC AGGTCCAGCC GGTCACGACG GTAATGTAAT CGAGAGATTT     43560
     TGATCGTTTG ACGATATCCT GCAGAATGTA TTCATAGGAA TAGTCGCTCA TGTCGAGCTC     43620
     GGTGGGATCG GTTTCTCCGA CTGGACGGTT TTCGAGGAGC CATGTGCGCA GGCTGCTAAA     43680
     GCCATCGTCT TTGATCGCCA GAAGACGTTC ATAGTCTTCA GGTTCGATGG TAATAAGATC     43740
     TTGTGGGCTT TCTTCGTGAA AAAGATAGAA GCCATTGCCG TCTTCTTCAT ACTGGAAGAT     43800
     TTCGAGAAGG ACGGTTTTTT CGAGCTCCGT CATATCGGCT TCGGGGATGG TCTGCTGGAT     43860
     GACGGTAGGC GAGGAATAGT CAGCCATGAG GGCCTCCAGA AATGCAAAAA CCCGGCTTTG     43920
     GCCGGGCTTT GAATGAATTG CGGGCGGTCA GAAACATTCT GGTGAGCGGC GCTGTGGTCG     43980
     CAATAGGCGT AGATGGTTTA CCTTTCTAGC GATCAGGCAA CCCGTGCCCA AGCGACGGGA     44040
     TAGGCAACGC CGTCTTCGCC GCTATCGGGC TTCAAGGGGT AATATTGCGC CCATGGCACG     44100
     GTGTTGTGCC GGGCTTCCGT GAAGTTGATG TCTCCATCGT CGAGCTTGAG GAGAATGGTG     44160
     ACATTGTTCG GGCAGTTTTC CATATCATCG TGCCAAGTGA TGTCGCTCAT GGGCTTTATC     44220
     CTTATGATTG GTTGATGACT TCGGTCGAAA GGCATGATCG TGATCAATCA CGTTGATCAT     44280
     CCTCTTCTTC GTCATCATCT TGATCCGCCA GCCTTGCATG GCAGGCAGGT TCGTATTCGA     44340
     GCGTGCAGAC AATCTTGTTT TCACAGTGAG GGCAGGTGAT GGTGCCCTCA CCGACATCGC     44400
     CGAGATCGGT GTAGCATGCG GGGCAGGTCC AACGGCTATC ATGGTTGGGA TTGCTGCAAT     44460
     GATCAGACAG AGGCTCTTTT GGCATAACGG TCTCCTTTCA AGTTCAATCA GATGAGTCCA     44520
     AGAGCTAGGA GCCAAGAAGG TGAGCCATCA GGACCATGGC CATCTGGTTC GACCTCGTGG     44580
     CCGGTCGGGG TTTCACACTG GCCGTCGGAC AGCCATTCCT CGAGTTGTTC CATGGAGGGT     44640
     AATTCTTGGA CGTCCAAGGC CCAGGCGGGC CTGTTCGCCA TCTCTTGTTT TCTATTATTG     44700
     AGCCATTCCT CGATAAGTAC GTTTTCTTTT TTGCGGCGAA GGACTTTCCA ATCGTCGTCT     44760
     TCGAGCCTGT GCAGGAGTTG AACTCCTTCC TGCGCGATGA CGATCATTCC GCGATATTTT     44820
     GGACTGAAAT ACCGTTTTAC CTCCGTGTAT TGATCGAGTG TGGACATGTG TATGTCTCCA     44880
     AAAATGCAAA AACCCGGCTT GCGCCAGGTC GTGAAGGGAA GGACAGAGCT GAGAAGTGGG     44940
     AAGTTTCAGA GCCGGTAGGC CGCGACCATT TCCTGCGCGC GCTCATGGTG CTCGAGCATG     45000
     ATCCTGTAGA AGGTTCTCCG ATCAGGCCGG AGCTGAGGAT CCTTCAGCGA TTTGGGATCA     45060
     AGCTTCTTGA TGGCAGCGCG CACGACCGTC TGCCAACTGG CATCGACGGG GAGGTTCAAG     45120
     CGGTTGTAAG TTCCAAACAT GGCGAAGTTT CCTTTTTTGA GGAGAGGGAT TTGGGCTTGC     45180
     GGAAGGGAAG ACGGGGCAGA TCGGGATAGT GGGTTGGTCC CTTGGTCAGG CCTTCGTCAT     45240
     CGTGCAGGAT CAAGGTGTGG ACGAGGGTCG TGCGTCGGCG TCCCGTCCGT AGGGAACGGA     45300
     TCAGCGCGGT GTCGGATCGT CGGGAGACGT AGCGGTTTTC CCAATAGCCG GTCAGCGGAT     45360
     CCTTGATGGC GGCGCCCATC AAACCGTTGA AGAAGCCTTC GACAATCCAG GGTTCTCTGC     45420
     ATTCGGCTTT GCCGCGAAAG CGATCACGCC ACCAGCATGT GGGTTGGATA TAATAGATCG     45480
     AGCCAATGGC GATGGTGCCA ACACGCAGGG GATTGTCGCC GCCTTGGCAG CGTTGAGCGT     45540
     AATATTGACG GATCATTCAG GCCTCCGGGT CGATTTCGTA GAGTTCGTTG CCGTCATCAT     45600
     CGAGGAGCAT GCAGAACAGA CGTGTCCGGA TGATATTGTC CGGCTCGATA TGTTGAGACT     45660
     GGCCATCGGG CAGGACGACA TGGTTTGAGT CTTTTTCGCG GGCCTCGGCA TGAGCGGTGA     45720
     GGAGGACAGA GGCCGCGTCT CCTGGCGTTT TGGCCTCGAC GATGAATTCT CCGGTATCGC     45780
     CTTCGATCAA TTCCTCGACG AGGCGCAGGC GGTAGAGGGT CATGGGGAGT CTCCCTAAAG     45840
     AAGAGGGGGT GGGCTGATCA GGCGGCTTCC TCGCCATAGT CATCTTCGGC GTGGCCGAAT     45900
     GCGTCGTCTT CCATGCCAGC AGGTTCATGC TCTGGCATTT CGGCATCGGC GCCGTTGACG     45960
     TCCCCTTCGG CCTCCGGATC GGTCTCATCG TCGTAGGTTT CGGCCGGTCG CGTGATTTTG     46020
     GCGATTTGCT CATCGTTCAG GGCGAAGTGG GCAAGCGGAT GAATGTAGGG GGCTTCGCCG     46080
     ATCTGGCCGA GAACAGCGGT GCGGGTGTCC TTGACGCGAT CGCGGGGCAG GACGCCGAGA     46140
     TCGGAGCCGG CTTTTTCGAG GGCCGGCCGG GAGAGGCATT TGAGGAAATC TTCGCTGCCC     46200
     ATCGAGGGCA GATGGGCGTC GGCGCCGATG GCATCGCCAG CGAGCTGCGC GGGGAGCCCA     46260
     CTGCTATTCC AGCCTGTCTT GCAGGTGAGA ACATGGGCGA GCATGGTTCG GGCTGTCTGA     46320
     CGCAGGGTTT CGGGATCTTG CGTGAGATGG CCACCCTGGA TGATCGGGCC GACGAGGGTT     46380
     TTGAAAGTGC CGTAAGGCTG ACCAGTCTTG ACATCGACGT TCTGAGCACT GAAGGCCAGG     46440
     ACAAGCAGGC CGATGAGCTG CGTGTCGTCG ATCGGGTTTT CGGCCAGGGC TTTGTGCAGG     46500
     GCCTCGGTGC GGAAATCACC GATCATGTCC CAGCCTTTGC TGGTCAGGTC AGGCTTGGTC     46560
     TTTGCGGGGA TAGGCGTTGC ATCATCGGCA TGAGTTTCGG CTTTTTTGCC GTTTTGGTTC     46620
     TTGACCGGAG CGGGCATCCG GTAAGGCTGC TCATGAATAC GGCCACTGCT TTGATCGATG     46680
     GCAAAGGCAA TGAAATCCTT CTTGCCCGGC TTCGTCCAGA TGCGTTCGGC TTTGGGCGGC     46740
     AGTTTCATTT GGCCATAATC GCCCATTTCG ACGATCATGC CGTTTTTCGG CAGGTTTTTC     46800
     TCAAGCCAGG CCTGTTGAGC GGCAAGGAAG GCTTCGCGAT CGTTCGTGAA ACGATTGTCT     46860
     TCGTCGGCGG GACCGAAGAG ATCATCTTGC CAGGCGAGGC CGAAGGCGCG GGCGTCTTCA     46920
     TCTGAAAACC GGGCATCGGT CGCGAGAAAC TTGGTTTTTT GAAGAGCGGC AGCGATTTGA     46980
     TTCCAAAACG CTTGCTGGCC CTTTTTCGGC TTTTTGGCTT TCCAGACGGA GGCCTGATCG     47040
     TCCAGTGAGG CAAGCGCGAT GACTTTCAAC TCACTTTCCT TGGGCATATC GCCATGACCC     47100
     ATATGGTCGA GCATCGGCGG ATGGACTTGT CCAAGCAAGC GTAGACATTT GACATCACGA     47160
     ACGGTCATTG CAAGCCCGTG AGCGATGGCC TGCTCGGTCC AGTTGTTCTT GGCTAAGGCT     47220
     TCGATGGCGC GCCATGTGTC GATGAGCGAC ATGGGTGCCC GCACGGCGTT CTCCATATAG     47280
     GCGCGCATGG CGTCGAGATC GTCGTCTTTT TCGGTGACGA GCACTTTGAT CGTGGCAAGA     47340
     TCGGCGGCGA TGGAGCAAAG CGTGCGGCGT TTGCCGACTT TGACGAAGAG ACCAGCATCG     47400
     TTCTCGTAAA CGATCGGTGG CTGTAGAAGA CCGACAATGC GGATGCTGGC GATGAGTTGA     47460
     GCGTCTTCAC ATTCGTCGGC CGCGATCCTA CGGGGATTGT CGGAATCGAA TTTCAGGATG     47520
     CGGGGATCGA CTTCGCGCAG TTCCATGTTC GTCATGTCTC AATCCTTTCC TTTTCTGGAT     47580
     TCTGCCCTCC CTTCCGCGCT TTTGCCGGGA CCCCGGCACC CATGCGGGCG AGCCCGCCTG     47640
     CCTTGCGCGG GACGCGGGGC GCTTGCGCCT TGCGGCCAAG CGAGGCCGGT GGCGCGTAGG     47700
     CCGCGTTGGA CCGAAGGGAT GGCGGGGACC GGCCAAAGCG ATCCGCCTTC TCTCTCTTCA     47760
     TTTTTCGGGG GGAGGAGCGA TCAAAGCAGG GGGGTGAGGA GGACCCGGTA GGCGCGGATC     47820
     ATCGCCGCTA ATTGGGGATC ATCCTGGGTG CGCTGTTCTA TAGTGCGCAC GGCATGCAGG     47880
     ATCGTCGTAT GATCGCGTCT GCCCATGGCC TGACCGATCT GTGGCAGGGA TAAGGGCGTC     47940
     AGCATCCGGG CGAGATAGCA GGTAATTTGC CGGGGTTCTA CGATACGCGC CTTGCGTGAG     48000
     CTGGATTTGA GATCGTCGAT GGTTACGTCA TGGATCTGTG TAACGAGCCT GAGGATCGTC     48060
     TGTATCCTGG GCTGCTTTGA TCGAGGCTTG AAGAGATCAG GGGCCGGAGG CTGAGCCAGC     48120
     GAGCACGGAT GGAGAAAGAA CGAGGACCGG ATCGGGAGTT CGGGAAGGTA GAAGGCAGGA     48180
     GCGGGGGAGT GTTTTGCTTT GATCGCACTT GGCGGCGGTG GAATTTCCTC TGCTTTCTCC     48240
     GTAGTTTTCG AAGAACGCTG AGCAGCGGCG AGAAACCGCC ATGAATTTCC TTGCGGCGCT     48300
     GCATGAGGGT GGATCGATAG TCCTCTGTTG AATCGTCACA ATTGATGAGC ATGAGTGTGA     48360
     CTCCATTATG TCGTGCATGT GTGAGAGGCT CGTTGGGGCT CAGGAAAAGA GATCGAAGAG     48420
     TGTCGTTTGC TGGGGCGGGG CGGGTGTTGA AACCGGGATG GGCGCCGGCA CGATGGGCGT     48480
     GGAGGCGGAG GGTTTCGAAG GCAGGGGATC TGGCTCGTAT TTGGCCTTGA GCCGCGCGAG     48540
     CATGGCTTTT TCGCGGGTCT CTGTTTCGAT TGTGAGCGTG CGCTTATGCC AGTCGAGAAG     48600
     GCCGCTCTGC GCGATCCGGT GAACGACGAC GCGTTCGAGA TCGCTGAATG TATGCGCTGG     48660
     ATCGCCCCAG CAAGGGTAGC CGAGCGTTTG CTGTAAAAAC TCGATCTTGT CGGCGGTGCT     48720
     CGTGAAAAAG GTTTCGTAGA AACCATGCAC ATTGTAATGC GCAATGTGCC CGAAACAATT     48780
     GGAGAGCCTT TGATAGAAGG GCTTCTTGAA TTTCTCCTTG GGGCAATCCT CCGCCAGGAA     48840
     GCGGAGAAGT GCATTGCCAA AGGCGGCCTT GTCGGCGGGG CTGTCCCATT GTGTGGGCTG     48900
     GAACAGATCA GCCTCGAGCG CCGGCAGGCG CAAGGCTTTG GCGATCGCCG CGGGGATCAT     48960
     TGGAGGGTTC TCCGGGCAAA AAGTGGCTCG CATTTCAGAA GGCGTTTGAA TAAGTTCATG     49020
     ATTTGTTCCT TCATAGAAAA GGCGGGAGGC CAAGGAGGGA TTAGGCGGCG CAGAGGTATT     49080
     GGCTCCAGCC GATGTCTTCT TCCTCGGCCT TTTCGGCAGG GGTCAGTTGA AGCAGGGCCT     49140
     CGAGCTCGGC GAGGTCCTGG TGCTTGTCGT CGAGATCGGC CTGATGCGCG AAGGTTTCGC     49200
     CAAGGCGGGC GCGATAGCCA GGCAGGCGGT GTTCGGCCTC GGCGGCTTTT GCCTGCCATG     49260
     AGCGCAATTC GCCGTCGAAG CTCGAGAGGG CATGTTCGAG ACGGGCGATG ACGCCGAGCG     49320
     GAGTCAGATC GCCGGTGAGA TCGATTTCGA CGTCATCGGC TTCGCGCAGG AGCGCGCCAT     49380
     CGAGCCGGTA GTCACCGATC TTGTAGAAAC GCAAGCCGAT CGAGACGTTG AAACCGCCAA     49440
     TTCGGGCCAG TGTCCAATGG CCGTTCGAGC CTGCCGCGAT CTTTTCCGCC ATGGCTTTGA     49500
     GCAAGGCGCC ACCGGCATCC TTGCGTTCCC GATAGGGCCG GTCTCGGACC TGCATTTCGA     49560
     AAAGATCGCC CTTGGTCGCG CGCCGCGTGG CGAGATCGTT TTGCAGGGCG GTGATCTGTT     49620
     TTTTCGCACG TTCGAGCGTC TTTTCGTTCC GTGTTATTTC GTGGCGGACG GCGATCTGGT     49680
     CATCGAAATG CGCGTTGGCG AGGCGTTCAA GACGCGCGAC CTCGGCTTCG AGCCCGGCCT     49740
     TGCGCATCAG GCGTTCATCG CCAGACGCCA GAGCCTTGGC GAAGGCGAAT TGATCGACCG     49800
     TGGAGCCGAC ATCCTCGATA CGGCGGATGC TTCTGTCGCC GGACATGGCC ATGTCGATGA     49860
     AGCGGGCCTT GCGTTCGAGG AGCTGCCAGC CGGTGGCGTC GACGCTGCCC TTGGCGACAT     49920
     AGGCGAAGAG GCGGATTTCT GCATTCTGGT TGCCCTGGCG CTCGATGCGG CCTTCGCGCT     49980
     GTTCGATATC GGATGGCAGC CAAGGCACAT CGAGATGATG GAGGGCGATC AGGCGCTGCT     50040
     GGGCATTGAC GCCGGTGCCC ATCGTCTGCG TCGAGCCGAT GAGAAAGCGG ACCTTGCCAG     50100
     CATTCACATC GTTGAACAGG CGCTGTTTTG CAGAGGACTT CTTATAGTCC TGCATGAAGG     50160
     CGATTTCGCT CGCCGGCACG CCGCGCGCGA TGAGCTGGTC GCGGATCCAG GTATAGGCGG     50220
     AAAAGCCTCG CTTGGCCGCG GCGTTGGGCG TGCCGAGATC GGAGAAGATC ATCTGCGCGG     50280
     CGCCCGGTAG CGGCCAGGGC GTGCCGTCTG GCTGGCGATA GGTCCAGTCC TTCGTCTCCA     50340
     GCCAGATCGC AAAGGCATTA TCGATCAGCT TGTTGAGCTT GTTGCCGGGT TCGCCGTACT     50400
     TCAGTCCGAC AAAACGCAGA TCGATCGCCG CGTGCCGGCC ATCGGTGATG ACAGAGAGGA     50460
     GGATGTCATC GCCCTTCTGC GGCTTGCTGT GCCGGTCCTC GATCGTCTTG ATGCGGCGGG     50520
     CGAGATAGTT CTGATAGGCC TTGAAGGCGG AGCTTGCCTC GCTGGTGATG ATTTCGCGGC     50580
     GGCCGCCACG GATCGCCGGC AGTTTCAAAT GCTTGCGCAG ATCGCTTTTC AGGACGACAT     50640
     CGGCGATCGT GCGATAGATC GCCATCAGGT CTGCGACATT GACGAATTCG GAAAAGCGCG     50700
     TGACCGGTTT GTATTGGCCG GAGGGCTGCA ATTCGAGCTC GGTGCGCGTC TCCCCGAAAT     50760
     TGGCCGCCCA GGCGTCGAAT TCGCTGACGC GGCGTTCGGC CAGGGCTTCC GGCTGCATGT     50820
     AGCGCTGGAG CGTATACATC TCGCCGAGCG TGTTGGTGAT CGGCGTGCCT GACGCCATGA     50880
     TCAATTCGCG GCCGGCATTG ATGGTCTCGA TGTAGCGCGC CTTCGCATAG AGGTCCCAGG     50940
     CACGCTGCGA GCCTTTGGGA TCGACGCCTT TCAGCGAGCT CATATTGGTC GGAAAGGACA     51000
     GTTTGCGGAA TTCCTGGGCC TCGTCGACGA TGATCTGATC GACGCCGATC TCGCCGATGG     51060
     TCAGGAGATC GTCCTTGGTG CTCTGCAATT CCTTCAGCTG TTTTTCGAAG CATTCTTTGC     51120
     GGTCTTCGAT CCGCTTGCGG GTGATGCGCT CGCTTTTATC GACGGATTCC AGCAGGCTTT     51180
     GGTAAGTGTT GATCTGGTCC TCGATCAGGC GTTGTTCGAA GGCGGCGGGG GCCGCGATGA     51240
     GCTTGAACGC GGAATGGGTG ATGATAATCG CGTCCCAATG GCCGGTCGCG GCGCGGGCGA     51300
     GAAAACGTTG GCGCTTGTCC TTCGTGAAAT TGGTCTCGTC GGCGACGAGG ATCTGGGCCG     51360
     TTGGATAAAG CAGCAGGAAT TCGCGGGCGG CCTGCGCCAG GCAATGGCCG GGCACCGCAT     51420
     ACATCGCCTT GGTGATGAGG CCGAGGCGTT TCTGCTCCAT GATGGCGGCC GCCATGGAGA     51480
     AGGTTTTGCC CGCGCCGACC GCATGCGCGA TATAGGTCTT GCCCGCGCTG ATGATGCGCC     51540
     AGATGACGCG TTTCTGATGG AAGTGGAAAT TGATGACCGA GCTGGCACCG GGCAGGCGCA     51600
     GATGCGACCC GTCGAAATGG CGCGGCACCA GATTGTTGAA CGTGTCGTTG TAGAGGCGGC     51660
     AGAGGCGCTC CGCGCGCTCC GTGTCGGTCC AGACCCAGGC GCTGAAGGCG TCGCGGATCT     51720
     TGGCGAGTTT TTCCCGCGCG GCCTCGGTCT CGACAGCGTT GACCACTTCG GTTTTGCGCC     51780
     CATCTTCGGT GATGATGTCT TTGATTTCGG GAATGCGGGC GTTGAGCGCA TCACTCAGAA     51840
     GCTCGCCGGC AGGCGCGCGT TCCGTGCCCC AGACCGAAGT CGCGGCGGCC TGGCCTTGGA     51900
     ACGGGCTTTC ATCGATCGTC CAGATCGCCA GTTCCGGTAT GTGATGAATC GTTGTTTCGA     51960
     TCTCCATCGT CTCGCGGATG AACCGGACGA TGTCACTGAC GGGGATCCAG GATGCGCCAA     52020
     GGCGCACAGT GATGTCGGAG GGTTTGAGGT CAGCGGGCTG GACGGCCTCG AGCGCCTGGA     52080
     CGTTGGCACG GTAACGGAAA TCCGTCTCGG CGTGTGTCTT GGCCTCAACG AGCTTCCTGC     52140
     GGACATTGCC GGAGAGATAG GCATCGGCGC TCTGCCAGAC GTCGAGACCC GGCACGGTGC     52200
     TCGGGATGCG GTAGATCTGC CCGCGCAGGG CTTCGATAAC CTGGTCCTCG CTTTGCCCCA     52260
     GAAGCTCGCC GATCGTCGGC AGGTCGATCG TGCCGCGCTC GTGCAGGCAG ACCGCCAGCG     52320
     CATCGGCGGC GCTTTGAACC ATGGGTTCGA CAGGCGGATG GAGGACACGC TCGGTAAAGA     52380
     TCGGACCTTG CTTGGCCTCA CCCGTCTCGA TCGAATAATT TTCGATCGAG GAGACCAGCC     52440
     AGACATCGGG ATCATCGAGG AAAGGTTGCA GATTGGGCCT GCGCTGCGTC TCGCGGATGG     52500
     CGCCCGTTTT CGGATCGGTG GTTTCCGTGA CATTCGTCAG GTTGATCGGC TTGAACTGGC     52560
     GCACGAAGGC CTGATAGGCG GCGCGCAGGC GGCTTTGGGC CACGCCCCAA GGCTGATCGG     52620
     CTTCCTGGGC ACGCAGAACG GCGCGGACGG CGTCGCGGAC AGGGATCAAT GCCCGGATGA     52680
     TCCGCGCATG TTTGGCGAAA ATGCCTTCCT TGTTGGTCGC GCTGCGGATC GCGACCTTGC     52740
     GGGGCTCGCC GTCGATGATC TGGTGCAGTT CGTCATCAAG GAGGAGATAG CTGCCTTCCT     52800
     TGATCGTGGC GCCTTCGGCG GCCGTGCCGA CGACCACGCG CGGTTTCGGT GATGAGGGGC     52860
     GTTCCTGGCT GGCCTCGGTG GCCTGGACGA GATTTTGGGG CAGGGTGTCG ATCAGCGCGT     52920
     CGAAGCGATC GAACAAGTCT CCATCGGCCG GCATACAGCC ATAGGTTGGC CCGTATTGCG     52980
     AAGAGACGCG GGCATGGCGG CCAAGGACAT GCTCGGGGTG CGCAAGGTAA TATTCGTTGA     53040
     TGGAGAGAGC CGCTTCGCCA TCCTCGACCG GGAGCACTTC GGCGAGATTT TTCCAGGTGA     53100
     TGCCATTCGG TTCCTGGCCG GTCAGGCGTT TGTGGAAGAA CAGGACATCA AGGATGACGT     53160
     CGGTGCCGGC CGATTCCGCC ATGGCGCCGC GCGGAAGGCG GAAGGCGGCG ACGAGATCGG     53220
     CGCTTTGGGC GATGGCATCG CGGGCCATGG TGCTCGTCTT GTCGAGCGTA TAGCGGCTGG     53280
     TGACGAAGGC GGCGAGCGAA CCAGGCTTCA GCCGGTCGAT CGAGCGCGCG ATGAAATAAT     53340
     CATGCAGCGA CAAATTGAGC TTGCCGGTCG CATCATCGCC ATGGACCGTG CGGTCCGAGA     53400
     AGGGTGGATT GCCGATGGCA AGATCATAGC TGTCGGGAAG TTTGGCCTTG GTGAAATCCT     53460
     CATTGCGGAT CCAGGCATTG GGGAACAACT GGCCGGTGAT CCGCGCGGTG ACCGGGTCCA     53520
     TTTCGATGCC GGTCAGACTG ACCTTCTGGC GCAGCTTTTC AGGCATGAGG GCGAAGAACA     53580
     GGCCGGTGCC ACAGCCGGGT TCCAAAACCT TGCCGCCGGC AAAGCCGAGG TGGCGCACGC     53640
     CTTTCCAGAG GGCGGAGACA AGCCGTTCGG GCGTGTAATG GGCATATTGC GTCACGCGTT     53700
     TGAGGCTGGC CAGTTCGGTT TGCGTGACGA GTTGCTCGAG GTCTTCAGTC AGCGTTTCCC     53760
     AACCAGGAAC GAGCGGGCTG TCGAGGCGGC GAAAGATCTT GTCGGCGACT TCGCCCGCGC     53820
     CGAAGGCGGT GAAACGGGCA AGGATCGCCT GTTCCTCGGG AGAGGCATTG CGGCCTTCTT     53880
     CCGCAAGCTT CTGCGACAGC GCGATGGCTT TCAGATTGTC GGCGGCGCGG GCTTTCCAGC     53940
     CCTTGGCGAG GCCGCGATCG CCCTCGAGAC GGAAATCGCG GGCGGGAAAA GGCTCGGTTT     54000
     CATGGGCAAG GGGAGATATT TCGCTTGGGA CAGGCGTTGC GCTGGCGGGC GTCTTGACGG     54060
     TTGGCCGGGC CGTGAAGGCG GGCGAGAGAG CGGTCGTGTC GAACAGGGAA AGTTGGAAGG     54120
     AATCTTTGCG GGAACGGGCC ATGGGGTCCT CAAGACGAGC GCCTTCCACG GCTGGCCTTG     54180
     CGGCCGTCCG GGAGGGCAGG GACAAAGGAA GGGGGAGGCG AGCGCGCTTA GAACGGCTCG     54240
     ATGGTTTCGA GCGGGAGCAG GTGGAGACGG ACCTTGGTCT CGCGGCCTAT CAGGTCGATC     54300
     GCGACCCGCG CGTAATCCGT GAAAGGTTCG CCGCAGCGTT TGATGATCGT GCCGATGCGT     54360
     TCCTCGATCC AAGGCTCGAA GGTGCGGGGG TCATGGACGA TCCGCACACG CTGGCCGGGA     54420
     GCGCACCAAT TGGCGGCGCG TCCCTCGAGC TCGGCGCGTA GGCGGTCGGC GCGGTCGCGC     54480
     CATTGCCGGA TGGTTTCGCC CGGCTGCGGA TCGCGCCAGG ACCAGGTGCC GAGGTATTGA     54540
     GGGGCAGGCG GGAGAGGAAG CGGGAGGATG TCCCGCTTGT GGCTTTGGCC CCGGTCAAGG     54600
     GGTTTCTTGA CGGCGCTCAT GGTTCACCAG AAGCCATGGA CAGTGAAGAT GGCCATCTGT     54660
     TCGCGGCGGT CGATCAGATC CAGGGCGTCG CGATGGAGCT GGGAATATTT GCGGGCCTCA     54720
     TCGACGACAT GCTTCCAGGC GTCGCGATCT TCGCGAAAGG GCGAGGTCCC GCGTGTCGTT     54780
     TGAATCTGGA TCTTGGCATC GCCATCGGCG TAATGGCCTT CCGCGATCAG ATCCCAGCCT     54840
     TCACGGCGGG CGGCTTCATG ATTGAAGTGT TGAAACAGGC TTGAGAGCTT TGCCTCTGGC     54900
     GGAGAGGATG TCGGTTGTTC GGGATTGGGC TGAGCCACGC GCTCTTTCAT GGGATCTCCT     54960
     TTCTTCTTTT CCGAAGACCC CTTTCCGCGA CCACAAGCTG GAGGGTGGGC TGCAAAAGCG     55020
     GCGCTTGCGC CGGGATCGCG CGGGCCCAGC GCAGCGGCCT GCGTGACCCA CCTTTTGCGG     55080
     CCGGCACCCG CTTGTGGTTT TTCTCTTCCC TCCCTTTTCT TTCTTGGATT TCGGCCCAAA     55140
     AAAAACCGGC CTGGGCGGCC GGTTCGTCAG CATTGGCACT TGGGTATGGC CCGCCATTGA     55200
     TGGGATGGAC GTGCCTTCGC CCTGTTAGGC AGAAGCTTGT TCCTTCTCGC CTGCGGCGAT     55260
     GGCAATATCG CGGTTGATCA CGCGTTTTAG TGGACCATCT TTGGTTATTG CCTTGTTGAA     55320
     ACCGGAAAAC AGGCGCGCGG TCTCTTGGGG ATGTTTGCAA GCATAGAGCT GATAGCAGAT     55380
     GCCGCTATCC TTAAAACTGT CGGCGAAGGC GTTGTATTCG GCGATCAGCT CTTTCAGTGA     55440
     AGAAACATCG ACCGTTTTTT CCGGCTTCGC CCCGAACAGG CTGGACATCT GGGTCGAGGT     55500
     AAAGCCGGAG GCTTTGCTGA CGGTGATCGC ATCGATCTTG TGGGCTGTGA TGATATATTT     55560
     GGCCATGAGA AATCTCCTGA AATTTTGACG GTCAAAGACG ACAAAGCCCG TCACGAGGGA     55620
     CGGGCTTTGA TGACAGCAAG GTTGCGAGAA CAAGCAGGCG TGGATCAGGG CAGGCTCTGC     55680
     GTCAGCCTTT TGACGCGCTG GCGCCAATTG GCGAACCACT CGAGGAAATC GGCTCCGGAG     55740
     ATATCCTGAT CGTTCTCGAA TTCTGCGGAA TAGGCGGTGA AGGCTTCTTC CAGCAAAAGC     55800
     GCCATATCCC GGCTGGCGAT GAAGAGCTGG GCGTTGGCGC GTCTGCGGTC CTGGTCCTGA     55860
     TCCGTTGGAC CAATCGGATG CATCTTGGCG ATGATGCTGA AATCGCCAAG GGATTTAACG     55920
     ATGTCCGTCG GAAGGATAGT GCCATCGGCC ATCGGCCATT TCTTGAGTGC CGGGCTCGAG     55980
     AATCCAGCGG CCAGAAGTCG AGTGTTCGAT CAGGTCAGTT AGCTTGTTCA TGCCGCCTTC     56040
     TCCAGGGCTT CGTTCTGCCA GGCGTCGACG ATGGCCAAAA TGGTGGCTTC GCTCAGACCC     56100
     GTCATCTGCG CGATATGGCG GATTTCGATC GCCACGACAT GCAGGATGAT GGCGCGCGCG     56160
     ACTTTCAGAT CGAGGGCCTT TTCAGTCGCA TTGCGCTCGG TCCGGGGCAG GAGGTCGTCG     56220
     AGGACATCGT TGACGGAGCT CGAACCCCGG CCTAGCAGGA GTTCAATCGC CTTGTCGGAC     56280
     ACGGCTTCGT CGGGATGAGA GGCGAGGTCG AACGCATTGA TGGTCGGTGC CTTGAAGGGC     56340
     CGCAAGGGGA TGACAGGCAC GGCCTTCGCC GCTTGCGGAA CGGTTTTGGG TACGGCCTTG     56400
     GGTGCGTTCT TGGCGGCAGC TTGAAGGGCG GCTTTCGCTG GGGCCTGGGG CTCGATGCGG     56460
     ACGCGCTCAG CCGCTCTTCG AGAGACGAGG CTTACCACGA GCTGCAGGAG TTTTTGGCCG     56520
     AGCGGTTCAG GGGTTAGAGC GTGAGGCAGT ACCAGGATGG AATTCATGGG GATCTCCTTT     56580
     CTTCTTTCTC GAAGACCCCT TTCCGCGACC ACAAGCTGGA GGACAGCTGC AAAAGCGGCG     56640
     CTTGCGCCGG GATCGCGCGG GCCCAGCGCA GCGGCCTGCG CGACCCACCT TTTGCGGCCG     56700
     GCACCTGCTT GTGGTTTTCT TCTCTCTTCT TTCTTGGATT TTGGCCAAAA GAAACCGGCC     56760
     TGGATGGCCG GTTCGTCAGC ATTGGCAGAG GATTGGATTT TATTTGAAGT GGATCAATAT     56820
     GCCGACAAGG GTGGCAAAAA CCCCGACCGC GGCAAAGACG ACAGTGGAGA GCCAGCAGGT     56880
     TTGTTCCCGA ACGGTTTTTT CGAAAGACGC ATTCGATTTC TCGATGGCAG CGGCAAGGTC     56940
     CTTGTTCATG CGATCCTCGA CAAGCTCGAT TGTCCCTGTA GCATTATTTA TCAATGGCCC     57000
     GGGCGAGGGC CGTGGCCTGG CTCTCGGAAA ATCCCGCTTC CTTCAGCATT TTGGTAATGC     57060
     TCAATGTATC GATCATAAGG GCAATATCGC GGTTGATCAC GCGTTTTAGT GAATCCATCT     57120
     TTGATTATTG CCTTGTTGAA ACCGGAAAAC AAGCGTGCGG TCTCTTCGGG ATGTTTGTAT     57180
     ACATAGCTGT CGTAGCAGAT CCGTTGTCAT AGCCATCGCC GTAGCAGTCG ACGGGATGGC     57240
     CGTAATAATT CCTCACGAAT ATTGCACGAT CGTCCCGGTT GGAGTTGGAC ACAGAACCGT     57300
     GTTTTGCCGC TGGTAAAAGG GGTATAAACT TGAGCAATAA TCCTAAAGCC GAAATGCGCC     57360
     GCGACCGCGC TATTTCTGAA AGGTGTAGGT GGGAAGGTGT TGCCGCGTTT CATGCTGGTA     57420
     AATCTTTGGA AGACAATCCT TACGAACACG ATCGTTATAA TTATTCTGAC GAGCTCCATT     57480
     ATTGGCGAGA TGGGTTCATG ACCGCCAAGC GAGAAGCTGA AATCCCGCGT ATAAGGCCTA     57540
     AATCGGCGGA GGACGCCTTA AGATTAAGGG AAGAGCACGA AAAAAAATGA CCGAAGCTGG     57600
     GGGCGAGCCT TTTGGCCGCC AGACATAAAC AAAATAGAGA CATTCAATGT ATGCGTAAAG     57660
     TCGCCGATCG TCACAGTCGG CTAATCATCG GTGTGTGTTG TGTGCGTGGT TGAAGCGCAG     57720
     GCGGAACAGA GGTTCGGGGT GGCCCAGGAA CAATTGGCCG AATCCGTGGT GCAAGCGTCT     57780
     TCCTCGGAGC AGCCACAGAT CATGCAGACT TGGCCAAGCT GAGAGGGAAC AGGGAGGATG     57840
     TCCTCGTCGA GGATCTTGCT GAGAGCGTCT CCTGCAATGG AGTAAAGCGC ATCCTGCAGT     57900
     AGCGGCTCGA CGGCGATGAA CGGACGCGTC GCTTTAGGGT CAGGACTCAA ATAAATCAGA     57960
     TCCAATAAGC TACGGTAGCG ACGAGGCAGA GTGCAGAAAA GAAGTTCTGT GCGAGTTTGT     58020
     CATACCGTGT GGCAATCCGC CTGAAGTCCT TCAGACGGCA GAAACAGCGC TCAACGACAT     58080
     TGCGTCCTTT GTAAGCCTGT TTGTCGTGGC GGATTTTCTT CTTGCGGTTT GACTTGCTGG     58140
     GGATTGTGGC CTTGATGCCG TGCTCTTTGA GAAAGGTTCG TATGGCATCT GTATCGTAAC     58200
     CTTTATCAGC CAAAAGTTCC TTGATACCCG GAACGAGGCT GACGCAGGCC TCGGCCATTA     58260
     CACAGTCGGC GGTATTACCT GGCGTGAGGA TGAACGCCCA GGGACGGCAG AACTGGTCGA     58320
     CGATCGCGTG GATTTTGCTG TTACGGCCGC CCTTCGTGAG GCCGATCGCC TGCGCTTCAG     58380
     CCCCCCTTGT CCACCGGCCG CACAGCGGTG GAGTTTCACA TGCGTGCTGT CCAACGCGGC     58440
     CTGTTCTGGG GCTGCCTCGG GAGCGGCCGC ATGCGCGAAA ATCTTCTGCC AAATGCCGCG     58500
     TTCGCTCCAG CGGACAAAGC GATTGTAAAC CGTCTTGAAG GGACCATACT CCTTCGGACA     58560
     ATCTTTCCAG CGGCAGCCCG CTGTCAACAC ATGCATGATC CCGCTCAAGA TACGGCGATC     58620
     ATCCCCACGC TGAGGCCCTG GCTGGTTCGT CGGCAAATGC GGGACGATCT TCGCCCATTG     58680
     TTTGTCACTG AACCAGAATA AATTCGTATC CATCGACTTG GCCTCCACCC TAGACCAAGC     58740
     CATTGAATCA AAATAGGGTT GATTAGGTCT TAACCCTAGG ATCGTCATAG GCATCCTGGC     58800
     CGTTCCAGGC AAGGATGAGC TCAAGAGCCA GTCCGCCGAT CTCGATCTGG ACATCTTGTG     58860
     GAAGCTGAAC GAAGGCCTCT CGGCCATTAA ATCGACTGGA AAATCGCTGG GTCATGGGCG     58920
     TGCTTTCTTT CATTCAGCGG CTTGCGAAGC CAGAAGGATT TGTTCCTCGG CATGAGACTG     58980
     CATATCGTCA ATAACGAGAG CGATCGCGCG GCCGACGACT GATGCGGGTG AACCGTCTTC     59040
     GTCTGCATTC ATGGCAGCAT GCACGACCTC GAGAGGCATG CCGTATTGGA GGCCGATCGA     59100
     AACACCAATC ACGGCATCTC GAATGTTCGC TTCGATCTTG CTGCCGGGTT TGTTGCAGGC     59160
     GATGAAGAAT TCACCGACCT TGTCGTTCGG CAGGCGGGAA TAGGAGACGA TCCAGTGAAC     59220
     ACCTTCAGCT TCGAACGGAA TGGAGGTCGA TTCACGGCGG TTCGGAAAAC GGTGTTTGAC     59280
     GGCTTCTGTC ATTCTTTCCT CCTTTTGACG TCTTCACGAT GCGAGAAACA GCTCCAACGG     59340
     CCTTCAATGC CGTGCAGGAG GCTCACGCCG AACCCGAAAT GAGCCGGCTT GCCGCAAATC     59400
     AGGCAGGTGT GAGCCTGGAG CTGGCGTTCG GTCCGAGGGG TTTCCACGGT TGTGTCCGCG     59460
     TCATGTCTGG GTGTCTTTGA AAACAGATCC GGCATGGCAA CCTCCTTAGA AGGAGCGGGC     59520
     ACGGCGCGGG TTGTGCCAGG CATTGGCCTT CCTTTCGCGC TGCACGGGAG GCAGGCCGTC     59580
     ATCGCGCAGC CAGCCCTCGA TCCGATGCTG CGGCGGAATA TCGGCGATGA AGCTCGAAGG     59640
     ATCGGCCAAG CCGCGCCGGT ATTCGCAGTA GGTGATCGCC GCGCGGCGTT TCGCCCTTGT     59700
     GATCGCCACA TAGGCGAGGC GGCGTTCCTC ATCGAGATCG CTGTTGCCAG CCGGGAAAAT     59760
     GCCGTCCTCC CAGCCCGGTA GAAAGACATG CTCGAATTCC AGGCCTTTCG ACTTATGGAG     59820
     GGTCATCAGC TTGAGACGGC CTTCCTCGTT CTCGTTTGGC CGGCTGCTTG CGAGAGCCGC     59880
     ATGGTCGAGG AGCTCATGCG CGTCGTGGAA GCTGCCGGCC AGATGCAGGA GCTCGCTGAT     59940
     ATTCTCGAGG CGGGCTTTAC CGTCTTCAGC CTTGCTGGCT TGCAGCATGG CGCGATAGCC     60000
     GGTTGCATCG AGCAGCAGGG AGAGCTGGTC GGCGAGCGTC AGGCTTGGAT CCTTCGCGAC     60060
     CTTTTCGATC GCCGCGACGA ACATCAAACC GGCCTTGCGG CAGGCGGATG AGAGAGTGGC     60120
     GGTCTCGATC GCCCGGAACA GCGACAGATG CCGGAAATTG GCTTCTTCCT CGAGAATGGC     60180
     CATGGCCTTC TTGCCGAAAC CGCGCCGCGG CTCGTTGATG ACGCGCCGCA AGGCTTCATC     60240
     CGATTGGCGG TCATCGGGCG TCGTGGCGAT CCGCAGGAAG GCCAGAGTGT CCTTGATCTC     60300
     GGCGCGCTGG TAGAAGCCGA CATCGCCGAC GATGACATAG GGAATCTTGG CCCGCACGAG     60360
     ACACTCCTCG AAGCCGCGCG AGAAGAAATT GTTGCGGTAG AGGATTGCCA TTTCGGCGAA     60420
     ATCGACGCCT TCGGCATGCC GTTTCTTGAT TTCCTCGACG ATGCCATGGG CTTCGCCATC     60480
     GCAATAACGG TAGGCCACGA CCTCAATTGG CTGGCCATAG CCTTTGTTGG TGAAGAGGGT     60540
     CTTGCCCAGC CGGTGCGGAT CACGGGCGAT CACGGCATTG GCGGATGCCA AAATAGCTCC     60600
     GGTCGAGCGG AAATTCTCCT CGAGGCGGAT CACCGAGGCC TGCGGAAAAT CCTGGGTGAA     60660
     GCGGCGGATA TAGGTGATGT CCGCGCCGCG CCAGCCATAG ATCGCCTGGT CATCATCGCC     60720
     GACACAGAAG ATGCGGTGAT GTTCAAAGGC GAGCGCGCGC AGCCATTGAT ATTGGGCGTA     60780
     ATTGACGTCC TGATATTCGT CGGCGAGGAT GCAATCGAAA CGGCGCGCCC AACGGGTGCG     60840
     ATAGGCGGCA TCACGCAGGA GCGCGCGCGT CGGCCAAAGC AACAGATCGC CGAAATCAGC     60900
     GCTGTTCTGG TCGCGTAAAC GCTGCTGATA GAGAGCATAG ATCCTGGCGG CGTTGAAGAG     60960
     GCTCGCCGGA TGGATCGGCT CTCCGATTGC ATTGGCCTCG GCAATCTTCT TCTGGACATA     61020
     GGCAGGCGCC TCGTCCGGTG ACAGAAGAAG GTCCTTGAAC TTGCTGATCT GGTTGATCAT     61080
     CCGTTTGATC GGCTCGGGGC CGGATTCATT GTCCTGCTCA TCCGTGTTCA GGTTGAGGGA     61140
     CTGCATGATC CTCTTGATGA GGCGCCGGCT GTCATCGGCG TCGAGGATCT CGAAATTGGG     61200
     GCGCAGGCCC GCGACTTCTG GTTCTGCCCG CAGCTGGCGG GCGCCAAGTC CATGGAAAGT     61260
     GCCAAGCCAG GATGGGGTAC TGCCACCCTG CAGGGCCGCG CGGATCCTGT CGCTCATCTC     61320
     GGATGCCGCT TTATTGGTGA AGGTCACGGC CAGGATGCGG GACGCAGAAA GGCCTTCCAC     61380
     GGCGATGCGA TGAACCACGG CGCAGGTGAG CGTCGAGGTC TTGCCGGTGC CCGCGCCAGC     61440
     CAGCACGACG ACCGCGCCAG GGGCGGAAGC GGCTTCGATC TGCCGGGGCG TCAAGCCCTG     61500
     TGTCAGGACC GTGAAAGCTT CGGAGGACGG GGCATACATC GGCCGATCGT CCATGAAAGA     61560
     CGCATAAGCG TCGGGATCGT AATGATCAAA CTCGTTCGAC ATGGCAATTC CATCCATAAA     61620
     TTGTGAGGAG CTCGCCGGCA GGCTCGCAGT CGAGAGAAAA CAGGGTGAAG GCGCGGTCGA     61680
     AATCGTCGAC GTCTTCATAG GGCTCGTCTC GATCGCCGAG GACGATGCCG GTGAAATCGG     61740
     TATGGTCGGC CTCGACGTAG ACAAAGGGCG TGTTGTAATC AGGCTTCCAG TAGCGCGCGC     61800
     GAATGTGTGC GGGCAGGCGG GAAAAGATGG CAAGATGCGC CTCGAAGATC CGCTTTTTCT     61860
     CGGTAAGGAT GGGAAGATCA CAAGGTTTCG ACATGGCAAT TCCAGGGATA GACACAGAGC     61920
     AGTTCGTCGA GATGATTGTC GCTGGTCACG AGGACCGTGA ATGCTGTCTC TAAGATCCAA     61980
     TCACCATCCG CATCCTGGTC TCCTGAGATG ACAAGGCCTT CGATCGCGCC GGAACCATCA     62040
     TGCGGCTCGA CAAACACATA TGTGTCCGTC AGGCTGCTCT GGTTGGATCG CCAGGTGGGT     62100
     TGGAGAGAGG TTCCTTCGGG CAGGCGGACG AAGGCGATAG AATGGCGGTC GTGCAGATTG     62160
     TCGTTCGCCG TCGCAGAAGG CATGAGAGCC GTCGTCATGG GCGGCTCCTA TTCTGCAGGA     62220
     CCTGGTTCCA GTCACCGCCC TCAATCGGCG GTCGCAGGCG CTCGAAGCGG ACTCCCGCTT     62280
     CCGCCGCGAG GATGGCGTGG ATGCCGGCAT AGCGGGCGCC GGCCGGATTA GCGTCGACGG     62340
     CGCTGATCAG CACGGGATCA GAGTAACGCT CGGCCATCTG GGTCAGGAGG GACTTCAGGG     62400
     CGGTGAGCGT ATGCGGCCCC ATGCCGCCGC TGGTTGCCGC ATAGAGCGTG TCGTCGCGCT     62460
     CGCCATGCAT GGCGGCAAGG CTCAAGGCGT CGATCGCCGC CTCGGTGAGG ACGAGACGGC     62520
     GCGGAATGTC CGTCGTTCCG AACCGGAACA GCGTCTTGCG GCCACCTGTC AGGCCGCCCT     62580
     TGTAGTCGGG TCCACGCACA TCGATGTGGC AGACCGTCCC GCGTTCGTCA CGATGCGCGA     62640
     ACCAGGCGCT GCCGACACGG CCATAGCGCA CGACATCGGC TCGTATGGCG GAATTCAGGA     62700
     TGGCGGCAGG CAGACCGCGT TCCTCAGTGA GGTAGCGCCA GCCTTTCGAT CCGGGCCAAA     62760
     GCTCTGGCCG CCTGTTCCAG CGCCAGGACA CAGGCCGATT GTCGTCTTTG ACCTTGGCTG     62820
     GTCGTTCGGG CGATGGCAGG GAACTGGAGA ATTCAACACG AGCCAGAGGC CGCAGGATCT     62880
     TGCGGACAAG GCCAAGATTG GTGCCCGGCT TGAGATATTG GACGAGGCTG ATGACATCGC     62940
     CCTTGACGTC GCTGTGAGGA TCCCACCAGC CCTTGCCGTC GTGATTGACG ATCAGGGTTT     63000
     CCCCCTTGCC GCGGCGGTAT TTGAGGGCAT TTCGTGTGCT CTCGGCCTTG TCGAGTGTCC     63060
     AAGGTTCGCC CACGCGTTCG AGGACAAGGC CACAATGGAT ATGTTCACGA AAGTGCATGA     63120
     GTTCAGGATC ACGGCTCATC GGCTTTCTCC CCTCTTCTGG CCTGGGTTCA GGCCCGCCTG     63180
     AACCCCTGCC TCGCGGCGAG TAGCGGGTGT GCAAGCGGAG CGCGTGGCTT CGCGGGGAAC     63240
     CGGCTGCACG GAGCGCGCAG CGCGGAGGAA GCTGGGCGGA AGACAGGCCG GAGCGCGCCG     63300
     AGGGCGGAGC CCTAAGCCTT TTTTCGTCAA GGAAAGAACC GATGCCGAAG AGCGCTTCGG     63360
     GTGCGAAGAA GGCTGGGATA TCGAAACCTC CATGATGGAT CGGATCGATT TCACCAGCCG     63420
     CTCACGCGAA AAAGCATGGC CGCGACGATT TTTTCGCGAT TTTCTCTTGC GCTTTTTGAT     63480
     GGGCTTTACC GCGCCGCCGC GCGGGGCTTG GGACTTTGTC TTGAGCATCG GGATCTCCTT     63540
     TTTCTGAAGA CCCCTTCCCG CCACCACGGC CCGGCAGGAC GCGGCAAAAG CGGCGCTTGC     63600
     GCCGGGATTG CGGGAGACCA GCGCAGCGGC TCCCGCAACC CACCTTTTGG CCAGCGGACG     63660
     CCGGCTGTGG TCCTTTCCTC TGTTCCTGTT TTTCCCTTTC TTTCACGTCC AGGTTCTGCT     63720
     TCTGTACTCG GGCGAACGGG AGAGGCCGCG CTAAGACGAG GACAGATCCA TGGAAGAGCT     63780
     GGCGATCCTG CTCGAGGCCC GCGCGCCGGA TTTGAACCGG CATCGGTTCT GGCGCGTCAG     63840
     GATCGACCGC GATCTCTTCG GATGCTGGAA TGCGCGCGTG ACCTTCGGCC GGATCGGCGG     63900
     AGCCGGCCGC ACCCTGCGCT ATGATTTCGA GGATCAGGAC GAAGCCCGCG CTTTCGTGCG     63960
     CAAAGGCCTC AAACGCCGCC AAGGCGCGCC ACGGCGCTGC GGCGTCGCTT ATCGGCTGGT     64020
     CGAGGCGTCG GGCAACGCCG AGGACCTGCT CAGCAGGGAA ATCTGGGCGC CAGCCTGCGA     64080
     ACCGCCTACT CCCAGCAGGC CCGCCTTGCC GCCATCCGGG CCAAAGCCGG GTGCATTGCT     64140
     CTCCCCTGCC CTGGCGCCGA CCTTATGGGA CTGGCTGCGG GCACGATCAA AAAGCGGTTC     64200
     ATAACTCGCT TTGAGGGATT GAATGGGAGA GGCGCGGCGC TATTTGTTCT CTTTATGTTC     64260
     TCATTTCGCT CGTTTCATCC CCTGCGGGTG CGCCGTGGTG CGCGGCGGCC CCTGCCCTAT     64320
     TTCCTCGAGG GCCTGTGCGC GGGTTTCCCC TCGCCGGCCG ATGATTATCT CGACGAGAGC     64380
     ATCGATCTCA ACGATCTGTT GATCCGCAAC CAGCCGGCCA CTTTTCTCTG GCGCGTCGAT     64440
     GGCCATTCTA TGCGGGAGGC CGGGATTTTT CATGGCGATC TTCTGGTCGT TGATCGCAGC     64500
     CTGGCGCCAG CGGATGGCGA TATCGTCGTC GTCATCGTCA ATGGCGAGCG TTCGCTCAAG     64560
     CGGCTGCAGA TCCGCAAAGG CCAGCTCACT CTCAGCTTTG AGAACAAGGA TTATCCCGAA     64620
     GGTCTCGCCT TGCATGAAGG TGATGAGATC GAGATTTGGG GCGTGGTGCG GTGTTCCATT     64680
     CATTGGCATC GGGCGGGCGG ATAATGAGCC GGATTTTCGC GCTGATCGAC GCCAATTCCT     64740
     TTTACGGCTC CTGCGAACGG CTGTTCGATC CCTCATTGGC CAAACGGCCG GTGATTGTCC     64800
     TTTCGAATAA TGACGGTTGC GCCGTTTCGA GGACGAGTGA CGCCAAGCCC TTCGTGGCCA     64860
     TGGGGCAGCC CTATTTTCAG ATCAAGGATG TTTGCAGGCG AGAGAATATC GCGGTCTTTT     64920
     CGTCTAATTA TTCGCTTTAT GGTGACGTTT CAGCCAGGCT CAACCAGGTT TACCGGCAAT     64980
     TTTCGCCGGA AATCGAGGTC TATTCGATTG ACGAAAGTTT TTTGGATTTC TCCGGCTTCG     65040
     GCGATCGCAA CCTTGAAGCC TATGCGCGGG AGCTCCATGA AACGATCTTC CGATGGGTCG     65100
     GAATTCCGAC TTGTGTTGGG ATCGCACCGA CAAAAACGCT GGCCAAGCTC GCCAATCGCG     65160
     TGGCTAAGAG CTCACCGGAC TTGGGCGGGG TCTGCGATCT TCGCGATCAG GGCAAGCGGG     65220
     AGGAAGTGCT CAAACGCGTG CCGGTTGAGG ATGTCTGGGG CATCGGCCGG GCGTCGGCAG     65280
     CCAAGCTCCA GCGCCTGGGC GTGATCACGG CGGCCGATCT CGCGGCCCTC CCCTCGCCGT     65340
     TCGCCCGCAA GCTCCTTTCG GTCGTGGGTG AGCGCATCGT CCATGAGCTT CAAGGTCAGC     65400
     CCTGCTTGTT GCTCGAACAA GTGGCACCAC AGCGCAAAGG CTGCGCGGTG ACGCGCTCTT     65460
     TCTCCGCGCG GGTGACGGAG CTCGATCAGA TGCTTGAGGC AGTCTCGGCC TATGCCGTGC     65520
     AGCTCGGGGA AAAATTGCGC CACCATAGTC TGGCGACGGA AGCGCTGACG GTCTTCTACC     65580
     ATACCTCCCC TTTCGATACG GGGCCGCAGC GCTCGGTCCA GAAATGCGTC ACCCTGCCCG     65640
     AGGCCTCGGC CGATACATTG ACGCTGCTGC GCGCTGCGCG GGACGGGGCG CGCGCGATCT     65700
     GGAAAGAGGG CTATCGCTAT GCCAAGGCGG GGCTCGTAAC GATGGATCTT GTCCGGCTCG     65760
     AGGATGCGCC GAGGGCTCTG TTCGATGCCT ATGACCGGGA GGCCTCGGCA AGGCTGATGA     65820
     TGGCACTCGA TGCAGTGAAT GCAAAGTTCG GGCGGGGAAC GCTCCATCCG GCCGCGGCAG     65880
     GCATCAAACG CCCGTGGTCA ACGCAATTCA ACATGCGCAG CCCGCGTTAC ACGACATGCT     65940
     TAGATGAATT ACCTCTCGTC TTTTAAAACA CTAAGAGAAA GATTATTCAT TGCACCACCA     66000
     CTAGCATGAC ACGTCTATTT TTAGTCAAAC TCTTACTCCG CTGTAATATC ACCAAGAAGG     66060
     CTCTCAAGCT CGCTTAGACG AGTCGCAACC TGTTCTAGCT CGATTTGGAG CCGCTGCTGT     66120
     TTCTTACGAA GATTATTTCT TTCTTCTTGA AGAACTGAGC GGTCGATCCT TCCTGGAGTA     66180
     GCAGCTTGAT ATTTTATCTC TTGTCGGAGG AGGCTAATCT CGCGTCTAGT CACATTAGGG     66240
     CGAATAAGAT CCCTCTCATT AGCGACTTTA AGTTGGTAAT CATCAAGTAG TGTGATCTGA     66300
     TATGCAGTAC CGTAGCTACC AGGGCAACGA TCGTAAGGTA TTCTGCCGCT ATCAACAGCT     66360
     CGAGCTATTT GCCGAAACTG GGTAGCTGTA GCATCAGAAA AAGGGAATAT GCGATCCGTG     66420
     CCGTACCGCA GTTTTTGATA CTCTAGCTTG CTGAGGATCG ATTCAAGCGA AAGTAACGCC     66480
     CGCCCAATAG ATAAAAACGA GTCTCTAGCA TCGGACCAAT TCTTCTGAAC CTCTGCACGG     66540
     ACATCGAGAA TTTGTTGAAG CCGCACATCA TCGGTGGCGA CTGGCGTACC CGCGAAAATC     66600
     TCCCTAATAG AATCAAGCAA CGATCCATCG ACGACGATAT GGCTAGCAAA TTCTGTAGCT     66660
     CGCTGATCGA AAACCGGAAC ATCTTCTTCA TCTGCTAGAA ATTCTTTCAA TGCAGACTTG     66720
     GTTCTTGTAC GCGGCGCTGT CACAGGCCCA ATCTCCTACG CACGAATGCC CAAATTTCCT     66780
     CAAACGAAGC CTGCCCCTTG CTCTTGGTAT AATCAAGCAA CGTCAGACCT TTCGAACTTG     66840
     GTACGTGGAC ATCCTCTAAT TGAGGTATCT CGACTGGGCA AACCTCTGCA AGTTTGATGA     66900
     GGCGCCCTCG AACCCGCGCA AATGAGGTCG TACGACGATT AGCACGATTC AACACAATAA     66960
     CTGCATTTTT ATTGTGCTCG ATCATCACCT GAATCCAGGG CGCAACACTA TCCATATCAT     67020
     CCTGAGTGCA AACAGCCGGC ACCAGAATCA TATCTGATTG ACTTGAAAGT TGAGTAATAG     67080
     CGGCAAGATG ATCTTCGACA CTCGGAGGAG TATCAACAAT CAACAAGGAT TTTTCTTTGC     67140
     CATCAGCAAT AGAAGAACGC CAATTCTTTA AATCTCCATG AACGACTTCA GCATCCACAA     67200
     ATTCCGGGAA CTTTACTCGA GTGGCCTTAC GCCGTTCTCC CCATTTACAA AAAGTACTCT     67260
     GGCGATCGTA GTCAACACCA AGAACGGATA TCCCGTCCTG AGCAGCACTT ACCATCAGAT     67320
     GGCGGGCTAG AACAGACTTA CCGCTGCCAC CCTTCGGAGA GGAAACAAGG AGTATTTTGG     67380
     TCATAGTAGA ATCGGCCCGC AGCTCAGTTC ATAGACCCAT ATCTTAGGAA AATACCCTCA     67440
     ATATCTAAAT CACGCCTTAA CATGCTAAAA ACGATTAGAC ACTGTCTAAT TGATCAGTGC     67500
     CGGACAAAAT AGCGGAGTTT AACCTCGCAG AGGCTATCCC GAGGAAACGA TTGCCAGGGT     67560
     GTGCTTGCCG CTTGATTGAT GAAAGGTGAC AAGACGATCA GCGACAAGCT CGCCAAGGTA     67620
     AAAATGGGGG AGGGAAGGTC GAGCAAGTAG CCACTCATAT CGCCGAGGCA AAACCGGGGC     67680
     TGCACGGCTT CATTCGCTCC AATCTCTGCC GCATGCGATA ATTCTATGAG GCTTATGTTT     67740
     CGTATCCAAA TGTCTCGGCG CTGCTGAGAC ATTTATCCTG GACGAATCAC CTCTCCATCC     67800
     TCTGCCAGCG CAAACGGCAG GAGAAACGGG ACTTCTACAT CGATCTGGCG ATCCGCAAGA     67860
     GGTGGAGTTC ACGCTAGCTC GAACAAAGGA TCAAGGGGGC TGTTCGAGCG CTCGATCCTG     67920
     TAGCTCGCTA AAGTCTTGGA GGCACTTAAT TGATCGGTTC GAGCCAAAAT ATCCGGGCAA     67980
     GCTGAGCTTT TACCTAGAAG TCCTTGACCG TACCGAAAAA AGTCGCACGA GGTACCATCG     68040
     ATCGGAGTGC TTCTCTACGC CCACAAGGAC GACGAGATCA TCGAATATGC GCTGAACCGT     68100
     ACCCTGTCAC CGACCTTGAT CGCCGAATAT CAGACCCGCC TGCTGAACAA GAAACTACTG     68160
     CATGAATTCT GGCTGCTGGA CAAGACGAGC GAGGAGGGCT CAACCTAAGC GGAGGCCACA     68220
     ACACAGCGCT CTGGGCTGGG AGCGGACTGG CAGCTTTCGA CGTGTGATGA AGCAAAAGCG     68280
     GACGGCATGC CCAGCAACGT TTATAGGGCT TTGCCTCACT ACAGACGTAT GGCGCCAACC     68340
     ACGGACTCCT GCAAAGCCAC CATGCGCCCA TCCAGTTGGT AGAAAGTATT CACTGAAGCG     68400
     GTTTACATTC GCACCGAGCG GCTAAGATTT GTTTATTCAA ACCCGGTGAC CGGATGCGGC     68460
     ACATAGGCCA CCTCGAGCGC GGTGATCTCA TCGTCGGTCA GCACAATTTC CAGCGAGCCG     68520
     ATGGCATCAG CGAGGTGATA AGGCTTGGAC GCACCCACGA TCGGCGCTGA CACCTCGGGC     68580
     TTCGTCATAA CCCAGGCAAG CGCCACCTGC GCCATAGGCA CGTCGCGCGA GCCGGCGACA     68640
     CGCTCGACAA CGCTAGAGCG GTTTTGCGTA GATTTGAATC GAAGAAGGAT TCCCTGAGAG     68700
     GCTTTGTTGA TGCATTTTGA TTGATCTCAA CTGGGATGGA TCATGATGCC GAGAGCCTAT     68760
     TCGACAGATT TGCGGGAACG TGTCCTTGCG GCGGTGGACG CAGGCATGTC AGCGCGTGCG     68820
     GCGGCGCGGC ATTTCTCCAT AAGCCCAGCA TCAGCGGTCA AATGGGTCCA GCAATGGCGG     68880
     CGTGATGGGA TCCGGGAAGC CGGTCCGCAG CGGGGGCATC GGCAAAGTGT ATTGGACGAC     68940
     CACGTGGATT GGTTAATGAG TATGCGGACT GAACAGCCTG ATCTCACGCT TGCCGAGATC     69000
     CAGGCCCTTT TGCCGGAGCG TGGGATCAGT GCCAGCCTCA ATTCGATCTG GCGGTTCTTC     69060
     AAGCGCCAGG GTCTGTCTTT TAAAAAAGAC CCTGCACGCC GCCGAACAGG ACCGTCCAGA     69120
     TGTCGCTCAA GCGCGCGCCG AATGGAGCAG CAGTCAGGCC GCGCTTGATC CCAAGAGACT     69180
     GGTTTTTCTG GATGAAACCG GCACGACCAC GGCCATGGCA CGGTTGCGTG GATGGTGCGA     69240
     GAGGGCAAGC GTCTGCTTGC CAAGGTTCCT CATGGTCACT GGAAAACCAT GACCTTCGTG     69300
     GCGGGCCTGC GCTGCGATGG TGTCGCCGCG CCCTTTGTCA TCGACTGCCC GATGAACCGC     69360
     GATGTGTTCC TGACCTATCT CCGCCAATGT CTCGTTCCGA CCCTGAGTGC GGGAGACATC     69420
     GTCATTATGG ACAATCTGCC GGCGCACAAG GTTGCTGGTG TGCGGGAGAC GATCGAAGCA     69480
     GTCGGGGCCA AGCTGCTTTA TCTGCCCCCT TATTCACCCG ACCTCAACCC AATCGAAATG     69540
     ATGTTCTCGA AGCTCAAGGC TCTGCTGCGT AAAGCCGCAA AACGGACCAT TCCAGCTCTG     69600
     TGGAAAAAGA TCGGCGCACT CCTTGAGACA ATCACACCAC AGGAATGCAC CAACTTCTTC     69660
     AAACACGCTG GATATGCCTG AAACTTACCC GAAAATGCTC TAGCTTATTC GGTCCGCCGA     69720
     TCTGTCCAAA CGATCGGGGC CACCTCAGAT TATGACAAGC CTTGATTGTC TCTCAATTGA     69780
     GAGACATAAT AAGCTGTCTC ATTGGAGGTC TCACATGGCC ACTCAAACCT CGATGCTGCA     69840
     TATCCGTGTC GATGACCAAC TGAAAGCACA GGCAACTGAG AAATTGGCCA ACGTCGGTCT     69900
     GACCGTTTCT GATGCTGTGC GCATCCTGCT AACCCGGATC GCCAAGGAAG GTGGCTTGCC     69960
     AGCCGGCCTG ACGACTGAAC CGGAAGCCTA TGACGCCTGG TTCCGTGCCA AGGTTCACGA     70020
     GGCGATCGCC GACCCTCGTC CAGCCATCCC GCACCAGCAG GTCATGGATG AGATGCAATT     70080
     CCTGATCGAT AGGAAGCGCC GTGCCCGTTC TTGAGTAGCG GGAAACGGCA CGTGCCGATC     70140
     TGCTGGCGAT TGTGGACTAC ATATCGGACG ATAATCCAGA CGCGGCCCAG CGGCTCAAGG     70200
     ATGACATCGA GACCAAGGTC TCGAAGTTGC CTGACTATCC AAAGCTCTAC CGGGAGGGCC     70260
     GTGTCATCGG TACGCGAGAA ATGGTCGTGC GCTCGAATTA CGTGATTGTG TATACAGAGG     70320
     ATGCTCGCGC TGTGACGATC TTGCGTGTTC TTCATGCGGC TCAGCAGTGG CCGCCCATAG     70380
     GGGAAGAATA AGGCGGGTGC GGCTGTCCAA TTTTGGCAGA TACTAGGAAA GGTTCCTTTA     70440
     TAATCGTGTT TTATGGAGTG GCTTTTGCCG TTCTCGCCTT AAATTTCCGA CCTTTGGAAG     70500
     GAGCGCTTTC TCAGCGAATT ACCGTTTCTG CAATGCGCTT ATCCTCGTAA TAAATCAGTC     70560
     CGGTGATCCG AAGAAGAAAT CCGCCGAATG GAAGAAAATC GGCACTGGAA AGGCTCGATT     70620
     TTTTCCACAA TCCGCTCATC CAGAGAAAAC GACAGCGATA CTAGCGGGGT CCGTTTTACC     70680
     AAGGGCTCGA TAAGCAATTG TTATCGAACC TTTGATATCT ATCTCCTGGC AGAAATCCTA     70740
     CGACCGGGAA TAATCAGATT ATGCTTGCCG GAAGACCGTT CAGCTCAGGA TTGGCTGAAT     70800
     TTTTCCACTG GTGATATCAC CTCAAAGAAA CAGTTCGAAT CCTTCCTAAC CTGGCATCCT     70860
     CGCCGGTTTA CTACACAACC CGATATTTCC GACGATTGCC ACATGACACC AAGCAGCATA     70920
     GAGACCATTA ATTTTACTCC ATAGCCCGAC TGTCCGCTAT TGGCGCGAGC AGCCGATGAT     70980
     CTGACATTCC TCTTGAGAAG TTTGGGTCGA GCCTGCGCAC TTTCCAAAAG CGCTTGGTCT     71040
     AGGCTCAGGA CTCATTGATT GAGGAAGAAG GCGAGGCTAG CAGCGATACA GATCGCTGAG     71100
     AAGAAGGTAT GGGCGCATCG GTCGTAGCGT GTGGCGATGC GTCTCCAGTC CGTGAGCCTG     71160
     GCGAAGAGGT TTTCAATTTT GTGGCGGGCG CGGTAGAGAT CCTTGTCATA GGGCAGCGGC     71220
     GCCTTGCGGC TTCTCGTTGA AGGAATGCAG GGTAGGATAC CTTTGGCCTC GAGAGCTTGC     71280
     CTGAACCAGT TGCTATCGTA ACCTCTGTCG CCGATGAGGG TCTTGGCCGA TGGCAGCGTC     71340
     TCGATCAGCA GCCCAGCGCC CTTTGATCTC TCATCTGGCC TTCGGTCAGC ACCATGCGGC     71400
     GCGGCCTGCC AGTTTCATCA CAGACGACAT GCAGCTTGGA GTTCAGGCCG CCTTTGGTGC     71460
     GCCCGATAAG ACGGGGAAGA GCCCCTTTTT GAGGAGGCTC GCCGCGGTGC GATGCGCCTT     71520
     CAGATGGGTC GAGTCGATCA TGATACGCTC CGGCTTTAGC CCCTCACCGG CGAGTGCCGT     71580
     GAAGATACGG TCGAAGACAC CGAAGCGGCT CCATCGGATG AAGCGGTTGT AGAGGGTCTT     71640
     GTGCGGTCCG TAGTCTTTCG GCGCGTCTTT CCATTGTAAG CCATGCTTGA TGACATAGAC     71700
     GATGCCACTG ATGACCTTGG GTCGTCGACG CGCGGCACGC CATGAGCCAG AGGGAAATGC     71760
     ATCGCAATCC GCGCCATCTG GCGCTCGCTC AGCAAAAACA AATCACCCAT CACGATCTCC     71820
     TTCCAAGACC GTGAATCACA GATCAATCCA AATTAATAGG TCCTGAGCCT AAATGTACCG     71880
     GCGATAGTCG GAACTAATCG ATTGGCCATC AGGAATATAT TTCAGCACCT CTCCAACCTT     71940
     ACGTGCCGCG CGGATTGGCA CTGGCAGGCG CTGGTTCATC TGGGTTGAGT TCCAGTTTAT     72000
     TTTGGTCAGC GAGAAGACTT CCTCGGCGAT CTGAGCAGCT GTGCTGTCAC TACTCGGGTG     72060
     CGGGCAAAGC AGCAGCGGCC TGGGAACATA GAGCCCCGGA TAGGTCCCGT AGTAAGGTAT     72120
     GCTCCCATTG GTGTAGAGGA GCCCCTTGCC GTCGAGATCG ACGAAAGTAC CTCGCAGGAC     72180
     GGGATAATCA CCGTCGCGCA GAATCTTGGC GTCGTAGGAT TCCTGGACCC ATACCAGGTC     72240
     GCGCAGCTCG GTCTCGGCTT CCTCCAGCGC ACGCAGGATG CCGTCAGCCT CATCATCACG     72300
     AAAGCGCGAC GTTTTCAGGA TGATCACCCG CGCCGGAGAA TGCTTGTGAT GGTCGCGATA     72360
     GGCTTTGAGA GCGCCTTTCA CGAGCTCGTA AGCATCCTCT TCCGTCATGT AGGGATGGCG     72420
     CCCGCGGCTT TCAGTTTGGG CGCGCTTTCC CTTGAGAATG AACCCGCGCC CGCGCTCGTC     72480
     GAACATCTGC GCAGCGCTGG TCCACAGCTG CTGTCCACTC ACATCGCGAT AGAAACTGAT     72540
     ACCGATGTAG CAGGCGCGAA ACTCGCCCTC CTTAGGGAGC CTGCGCCATG GGATGCGTCC     72600
     TGACCCTTTG TAGTAGAGGG TTGTCAACAG GTTCCAGCTT CGACCTGCCT CATCCTGTAT     72660
     CTTACGCTCA CTGCTCACCT TCACCTTGCG CGGAATCTTC GCCTTCTCGT CGATCACATC     72720
     CTCCCAAAGG ATCTGGATCG GGAAGTTGAG CGACATCGCC TTGGCCTTGA GGAGGCCGCG     72780
     AAAGTTCGGC GCATCAGAAC CACCCGAGTC ATCCTTTTCG GTCGTCCCTT CAGCATCTAT     72840
     CTTCGCATTC CACACCCGCT CGATCAGTGC CACGGGCAAA GCGACCAGCG CGACGTCTGG     72900
     CCGGTCGCCG CTATCGTCGA GCACCTGAAG CAGGTCGACG ACAGCATCGA CCGCCATTTC     72960
     CACTGCCTTG GCGTGATTTG GCTCTTTCCT GATTTTGTCG ATCTGCGCCT TGCTGAGCGT     73020
     GGCAGTAGCT TCGTCTTCGA TCACGAACTG GCAGCGAAAC GGATTGTTGT TCTGAAGGCC     73080
     AGGGAAGTGC GGGTTCATAT TCGGATGGCT GTCGGCCGTA GATTCGATCC CGTCTGCTGC     73140
     CTTCGCGAGG AATTGCTTTG CGGACCCCAC AGTTCTTGCG TCGCCAACGA CGCCGACGCG     73200
     AATCTTGTCG CCGAGCGGCA CCTGGAGCGG ACCAGCCTCG GTCAGACCTA GGCGTGGGTC     73260
     AGGATGGCTA TGCTGGTCCC CAAACTCCAG CAGAGGCTCG TCAAATATCT GGCTCTCAAA     73320
     CTTCATCGAA CAGCAGCCCC ACCTGATTGT CCGGCTCCTC AATCTTCGTT TTGGGCTTAC     73380
     CCCACGCATC CTCCGGCACG GTTGTGGGCA AATCGATCTC TGGCGGCGCC TCGAACCGAA     73440
     GTATAGGCGG TTCACCGTCG TCTTCTGACG CAAATAGGCC CGACTGCTCC TGATCACGCA     73500
     GCGACAGTAG GCGATGCCAC ATGATTAACT GGCCACGAAG GGATGCGTTG TTATCCAAGC     73560
     GCTTCTTGCC CGACAACAGT GCGTGCGGAT GGCTGTGCCG ATGGAAGCCG TTCGTAGTGA     73620
     AGTGATAGGT TGGGCTCACC ATCAGGAACC ACTGATCGAG CATGCCTTCG AACTTCGGCA     73680
     CGAAGGCATG GTGTCGCACG TATGAGACCT TCTGCGGATC TTTCGGTTGC ATCGCGACTG     73740
     TGACCACATC TGCGTGCGTC TTATTCTTCG CGGACTGGTA GTGGAACGTC CGCCCCTGAT     73800
     TTTCGTGGAG CGCCCGGATA TAAAAGAGCT TTCCCTCCTT ATCCCAGGCG AGGTCGTCTC     73860
     GCATCTGGTG CTGCAGGGTC TGGCGAAGCA GGAAAGCGAA GTTGTGCTGT TCGTCTATGT     73920
     CTTCATGGAA CGCCAGCAGG CAGGTCTCGA TTGCCTCAAC CTGATCGAGG TCGACAATTG     73980
     CACTGGTGAC GGCTTCGCGC GGGTCGTGGA ATGACCAGAA GGTGCCGCCC TTGATCGTCC     74040
     AGTCGAAACG TGTTGGATCG TCCTGGTCGT GGAGCTTGGC AATGGCGCGC TTGCTGTCGA     74100
     GCGGAGTGCT CGCCACGAAC ATTTCCGTTG GCAACACGAT CGGCAGGAGA TTGACGAGCG     74160
     CCGTCTCCCC GCCGCCCAGC GGCGGAACGT AATAGCCGAA GCCATTTTTC GGTACAGTGA     74220
     GCTGCGCAAG CCGATCGACG GCTGCCTTGT CGAGCGCGTC CGTCGCCTTG TCGAAGGTCA     74280
     CGCGGCGCTG CTCCACACCG GGCTGGCTGG AGATCGGTCT CCAGAACAAC GTTTCGTCGC     74340
     TCTCGCGATA GAGAACCAGG ATCACCGGAA GATTGGAGGT CCGCCAATAG TAAAGATCTT     74400
     TGCTGTTAAG CAGGTAGGAG AACCCGCTGT CGGTCTCGGA GGTGTAGGTT CCGGCCCTGG     74460
     TGGATTTCAC CTGCACGGCG ATCATCCGCG CCGTGGGCTC TCCCTCAATC ATAATCTCGG     74520
     CGATGCCATC GATGCCGGCC TCAAGCCGCC CGCGAAGGTC AAACTGGAAA CCCATCGACA     74580
     GGAAGCGCTT GCGGACAGCC GCTTCCCCAA GTTCGCCAAT CAACTGACTA TCGGTGATCT     74640
     TCTTCGCCAT GACTCATGCA TAGAACATTT TGGCAACAAC ATTAACGTGT TTTTCGCACT     74700
     GCAACCCGTC CATCGTCACG TTCGGCGGTG AGCCGCCAAA AGGGCGTCGG TACGCACACT     74760
     TCACCTCGAT CGATGGTCGC GCCGTCCTTA TTTCCGTGAT AGAATTAAGA AACGGGGCTT     74820
     AAAATGACGA GGGCGAAGCT GCATCGAATA GATCAATTGC TTGCTCGTCT TGGGCAAACG     74880
     GAAAAGATGC CTGACGTTTC GGTGCCGTGT TTCGAATGTG TCGCGTTAAA TCGGCTGCCA     74940
     GCTCAGTTGC ACCCCTAACG GTTCGTCGAT CGTTGCTATC TCGCCCATGA CCCTGACGCT     75000
     CGTCCCAATA GATCATGGCG AACTCTGCCA CGGCTGGACA TGGAATATCA ACGACGAGGA     75060
     CATGCTCGCC GAGCGCGTCG CGCGCATCGT GCTCGGCCAG TATCGCCATG TCGCCAAGAT     75120
     CCTGAGCGGT GCGGGCGTGC CGGGGCCCGT TGCTAACACC GAACAGGCGA ATGCGGCGAT     75180
     CAAGCAGCTG ACCCTCGCCG AGGGCGATGA TCCCTGGCAC CGTGACGGCT GGCTGTTCCA     75240
     GGCGATCTCG TGGATCGCCG CGCACCAGCA GCCTTCAGCC TCGCTCACCC GGATGCCGCA     75300
     TATCCGCAAG GCCGACAAAG GCTTTGACGG CATACAGCTC GAACTGAACG AAGCCGGCAC     75360
     TGCAGTCATC GCAGTCGTCG TCTTCGAGGA CAAAGCCACT GACAAGGCCC GCGACACCAT     75420
     CCGCGACGAT GTCTGGCCGG GTATCGTCGC TCTCGAAAAG GGTGAGCGGC TGAACGAACT     75480
     CAGCCAGGAA GTGAGTGGGA TGCTCGATGC GCGCGCCGCC GCCGATCCCG AGTTCGACCT     75540
     CGATACCGCG ATTGCCAACA CGCTGTGGCA CAATGCCCGG CGCTACCGCG TCAGCATCAC     75600
     AATCGGCAAC ACCCACAACA ACGCCGATGC TCGCGCCAAG CTGTTCAAGG GCTTCGACAA     75660
     CTCAGCGCCC GGCCCTGCCA GCCGCCGCCG TGCCGACACT ATTTACCTAC CAGAGATGCG     75720
     GAACTGGATG GCGAGCTTCG CCGCGTGCGT GATCCTCAAG ATCAAGGCCA TCGCCAATGT     75780
     TTGATCCGAC CACTGCGGCA TTGATTCGGG CGGCACCTCC ACTCGAGGGG CTCGACCTCG     75840
     ACAATCTGCC CAAGCGGCTG ACCGAGGCCT TTGCCGACAT CGTCTCGGCG CGCATCCGCC     75900
     TGCGCGGTGC GCCCGCCGAA GCGGACGACG AAGCGTTGTT GACAACAGTG GCCGAACTTC     75960
     GCCGCATCGC TGCCGCCCAC GAGACCTATG CCGCCTTGCT GCCCGACCGC GAGAATCGCG     76020
     CCTCGGCGGC GTTCGTCGCG GCCTCGGCAC ACCAAGCCGT CTCGCTGGCG CTGCGCGGGG     76080
     CTGAGGCCAC CAGCCAAGTC GACATGTCGG CGGTCAGCCC CGACATCTGC GCCACGCTGC     76140
     TCTTCCTCCT GGCGGAAGCG CATGCCGATG CCGCCGATGC CGCCAAACGC ATCGTGCCAA     76200
     CGGCGGATGC CGGGCCGATC GAGCGCGCCC TGCTGCTTGC GATCCGCAGC CTCGCGCAAG     76260
     GGCGGCTCGG GGAGATCGTC GATGCCGACG AGCCGGAGAT TGATGTCGAT GGCGACGATC     76320
     TCGGCTTCCG CGCCCTCGAC GCGCTCCGCC TGCTGCTGCT GCGCGGCGTC ACCAATCTCG     76380
     CGCGGCAGCT GCGCCTGCGC GTCGACCTCG CTCCCGAGGT GGGCGGTATC GTGCCGTCGA     76440
     GCGCGCTGTT CGCGCAGGTG CGCGTCCTCG CTAGCGAACC GATCGATGGC GCGGGCGTGG     76500
     CCGGCGAGAC GCTGCTCAGC CTCTATCCTG GCCCCTTGCA TCTCGCCAAT TTGCTGCTCG     76560
     GGCTCGAGGG CGACCTGCTC GGGACCGCGC TCAGCCGCAT TCCGACACCG GGCGGGGTCG     76620
     ATGATAATGA ATGGTGGCAG ACGCTTCGCC GCATGGCTCG GCAGCGGCCC TATCTCTGGC     76680
     GCAACCACCG CGAGGCGATC GATAAAGGTT ATCTTGAGCA GGGCGTGTCC TCGGCGATCA     76740
     GCTTTCCGAC GGGCGGCGGC AAGTCGACGC TTGCAGAGCT CAAGATCGCG ACCGCGCTGT     76800
     TGCGCGGAGA GCGGGTCATT TTTCTCGCGC CCACCCATGC ACTCGTCGGA CAGACCCAGC     76860
     GCTCGCTCAA GGGAACCTTC CAAGACTACA GCATCCTTGC CGATGTCAAC GAGGATGTCG     76920
     GCTTCGGTGA CGTCGTCATG CTCGGCGAAG TCACCGCCAT GACCCCCGAA CGCTGTCTGA     76980
     TGCTGCTGTC GGTCGATCCC GATGCCTTCG CGGACCTCGG GCTCATTGTC TTCGACGAAT     77040
     GCCATTTGCT TCATCCGCGC GAGGAGGATC GGAGCCGTCG CGGGCTTGAT GCGATGCTCG     77100
     CTATCCTCAA CCTGACGCGC ATCGCTCCCT CCTCCGATTT GCTGCTGCTC TCCGCTATGA     77160
     TGAAGAATAC GCAGGAGATC GCCGGCTGGG TCGCATTTCT GACTGGGCGC CAATGCCTGA     77220
     CGCTTGACTT GAGCTGGAAG CCGACTCGAC AGGTGCGCGG TTGCGTCGTC TACCCTGCCG     77280
     AGCAAATCAC TGCGCTTAAG GCTGTCCTCG CTCAGGCACA CATCGACTAT CCGAAATACG     77340
     ACAGCCCACC AGTCGAGGTG AAAAATGTGC TGCTTGCGCA GCCCTTTGGA TTGTTCAGCT     77400
     TGCTTCAGAC TTGGTCGACC ACCGACCGCA GCGACTATGC GCTCCTCCAA CTGCTCGCCG     77460
     ATTGCCATCT GCTGTCGAGC GGCCGCGCCA AGGGCGGCAA CTGGTACCTA ACCCCCAACG     77520
     GCAACGAGAC CAGCGGCGCG ATCGCCGCCG CTGCAGCGAG CGCGGGCATG AAGACGCTGG     77580
     TGTTCGTGCA GACGACAGTC TTTTGTGAGA GCTGTGTCAA GAATTACCCG GCCCGCGTCG     77640
     CCGCCAGCCA GATCACGCTT ACCGAGGAAG AGCAGAAATG GCGCACCCTT GCCGAAGAGG     77700
     AGATGGGGGG AGCCGGCTAT TGCTACATGA AACTCGCGGC TGATGGCACG CTTCGAACGG     77760
     GGGCCGCCAG CCATCATGCG CTGCTACTGC GCGAGGAGCG TGAACTGCAC GAAAGCCTGT     77820
     TTCGCCGTCC GGAAGGGATC AAGGTGCTAT TTGCGACCTC GACTCTTGCC CAGGGCATGA     77880
     ACTTGCCAAG CGAAGTCGTC ATCATTTCGG GAGATAGCCG CTTCGATCCG CAAGCCGACA     77940
     AAATGCAGAA GCTTGAGGCG CACGAACTGT TGAACGCGGC AGGTCGTGCG GGACGCGCCG     78000
     GCGAAGGTGC GCAGGGTTTC GTCTTGCTTG TGCCGAGCAA GGTCATCGAC TTCGACGACC     78060
     AGAACAACCA AATCAACGGC CATTGGATGG ACCTGCAGGC AATCTTCGAG CAGGCCGACC     78120
     AATGCCTCGT CATCGACGAC CCGCTAAAAG TGGTGCTCGA CCGCATCCAC GATGGCGTCA     78180
     CTCAGACCGG CGCCTCAGCC TATCTTTTGA GCAAGCTGCC GCTCGCAGTC GCCGGCGCCG     78240
     AAGTCGACCC GGCCGCGGTA CTGCTCAACA GGAGCTTCAG CGCCTATCGC GCGCTAATGG     78300
     CCGCCGACAC CGACTGGCTA AGCACAAGAG TCGCCTCAGC TCTAGCCGCG CGAGCCGCTC     78360
     TGGAACTCCC CGAACCCGAT CGCTGGATCG AGCAGGTCTC TGGCGCAACC GGACTCTCTG     78420
     TCGCGTTGCT CCAGCAGATC GTCGAACGGC TCGATGCCGG CGCCTTCTCG GGATCGGCGC     78480
     TCGAGGTGGT GGCGGCGCTG CTCGACTGGC TCGACGCGCA TCCGAGCCAG TTGCTCAGCT     78540
     TGGTGCGGCC GGAGAGCCTA GAGGAGATGT TCGGCACGCC TTATAAAAAC CTCGCGGACC     78600
     ATGAGGCACG CGGAAAGCAT GCGTTGTTTT GGCTGCGAAA GCTTTGGCCG ATTTGGATGT     78660
     CTGGCGTGCC GCTGTGCGAG CTCGAAAAGG CATTTCTCGG GCGCACCACC AAGCTCAAGC     78720
     AGTGCAAGAA TGCCCGTCAT TTCGCGTCGC GGCTCGTGCC CGACCTTGCA TTCCTGGCGG     78780
     GCCTTCCTGG ACGCTTGCTC GCGGCGCGGC TGCGCGCCGT CGAAGACGAG ACACCTGTCT     78840
     CCTCCGTTTT GGCGTCACTG AGCGGCGTCG TCCGCGAAGG CTGCGATAGC CCCGACAGTT     78900
     TGGCACTGCG CCTCCATTTG ACACGCTCAG TATCGCGCGT TGCCGCCCGC AAACATTATG     78960
     ATGCTATCCG CCAGCATATC CAGCCGGGCA ACCCAAACGA GGGCTTTGAA GAAACCTTGG     79020
     AGCGCATCCG CCATGCCGAT GTAGTCGCCA GCTTCGACGA TCTCGATAAC CTCGACGGGG     79080
     ATGGATGAAC GGGAGCCTGA CAAACTAAGT CTCTACACCA TCGAACGGCA GCTTCGATGA     79140
     TTGCCATCCC AGGCGTCGAA TGGCCAATAT GGGGCGCAAA GCGGAAAATG CGACCGCCGA     79200
     ACGTCCGATA TGGCCGCCGT TAGCTACGTA ATCACCGCCG AGCTTTGTCG ATTGCCGCAC     79260
     GAATCGAAAT GTCTATCTAT TCATCAAAGG CTTATGGTGA TCTCGTAGTT CTCATCTGGT     79320
     TCCGGCACGG CCCGCCAACC CCACCGATTT CCCTCTGTCG CCCGATATTC CCGCTGATTG     79380
     CCGCATGACA CCAAGCGGCA TAGAGAACCG CCGATTCTAC ACCGTAGCCC GATTCTGGGT     79440
     GACTCGCTTG CTACCCTGAT CGCCGAAAGT CAGACTGCTA CCCACGCGGT GCGTTCATGA     79500
     CAGAAGCTGG CCGAGAGCAG ACTGACAGGA TTTAGAGGCA AACTGGAAAA AGCGGACGGT     79560
     GCTGAGAGGT ATAGATCAAG GGCCCTGTAG CTATCGACTC GGCTCGGTAG CTGAGTTCCT     79620
     CTCTTCATCA AGGACCATCC AAACGCGCTT CGAATAGACT TGAAGATCGC CCTACACGTA     79680
     TGCCCGATCC GCATAGGCCA GCAGATCCGC TGCATCCCCC CATCGCTCCT GGTTCCCTCT     79740
     CCTGGGCCCA ACACCGCCCC TGACGATCGT CAGAACCTAA AGTAGTAAGG GCATATTCGG     79800
     CTCGCGCTCC TGGAGCATAT AGGCTTCGCG GATCTGCTTC AAAAACTGCG CCTGCCCGCC     79860
     GTAACTTGGA TGCCGGACCG CAATGACCGG GAGACGGCCA TCGATACGGC CAACCGCTTG     79920
     TGCGGCATCG TTACCGATCG CGAAAATCCG TCGCGGACGC AGCACTTCGA TCAGCAACGC     79980
     GAGAATTTCC TCACCGGCGC GCCGCTCTTT CGAATTATGC GTCCGATTGG TGAAGGGTTC     80040
     GCCGGGTTCA TGAGGATGGA GGGGGAAGAC GTTCCAGAGG AAGATGCGCG CGTCGATCTG     80100
     CGCGAGCATC TTCCAGATGA TCGCGGCCGT ACGCTCGGCG ACCACCGCGC CGACTGTGGG     80160
     TCGTTCGACT TCCAAGCCCC AACGGCTCAG ATGCGCACCG GCATGCACCT CGTCGGTGAG     80220
     GGCGAGCCCG GTACGCCTGC CACCGCGGTA GCCGAGATCG CGCCCAACCC AGATAGCGTC     80280
     GACCGGCGAC GTCGACGCGC TTTCGATCAT GGCCTCGAGC GCGGCCGCGC GTACCTGGGC     80340
     GGCATCGGCG CGGTCGTACA CGACGCAGCG GTCGGTATAG GGATTGAAGG CATTTTCGAA     80400
     CTGCAAGTCG CAGACTGCGC GCACGAAGGG GTGCATGGTC ATACCGGTTC CTCAAGAGGC     80460
     TCGTACGAGA TAGTACGTGC TTCCCGGTCG CCCACGATCC AGCCGCCTTG CGCATCGCGC     80520
     ATCTGCCTGA AAATGGCGTA GCCGTCTAGA ATGGCGCGTT CCCATAATTT GGGCGGGCAC     80580
     TCCGCGACTT CGTAACCTGC TACGAAGTCG CCAATCGTCT TCAGAACACC GAACGAGATG     80640
     CGCGACTGAT TTTCAAAGAA ATTCAGTTCT TTCGCGCGAG AGAATATCCA GGCCGTAAGC     80700
     CCTTCCTCCA CGACGATTGC ACGGCCGCTA TCCTGCTCCT CGTCATAATC CCTCTTGCTC     80760
     TTGCGCTTCT GCTTGATCAG CGCCCGCATG ACCGGAGACC AGTGGAGGAT CGCCGCATGG     80820
     GCAAAATGAA AGACGTCGTG AAACCGGTAT CCATCGCGAT CGGCAATATT GTCGGTGAGG     80880
     GGATCGCCGA TGAAGACATC GTTCCATTGC AGATAGGTCC GACCGCTCGC ACGCTGGCTG     80940
     ACCTTGATCC GAAACCTTCG CGGCAACTGC TCCTCGGCTT CGAAATCCTT GTCGAAATCG     81000
     GGGAGGCTCG AAGGCTCGGG CAATAGAAAC GCACCTCGGG TCTTACGAAT ATTCGCGCGC     81060
     ACGACCGTCG AGAAATTCAG CTCCGCCCCG TGCAGCGCCT CAAGGTAATG GCCCACAAAG     81120
     CGAATAAGGT CTTCCTTGGC GGGAGCGGCC CCAAGGAGCG CGGTCGCGGC ACGCCCAAGC     81180
     TCGAACAGAG CCGAGTCGAG TTGCACCGAT TCCTTGGGGA GAATGATCTG GGCCATGGCG     81240
     CCATGGCTGT AATCGCTCGC AGCGGCGACA TGTTTGTAGG CGCTCGCCCG GCTCGCTTCG     81300
     GTGAAGATAT CCTCGAGCGA GAAACCGAGC CGCTGGCAAA GCGCAGCGAA ATACCAAAGG     81360
     GTATCGCCGA ACTCCTCTTC GGCGGCCTTC CGGAAGCCGG GAAAGGCCGC GCCCTCGCGA     81420
     ACATGTTTCT TGGCGGCGGA CATAATACCG CCGACCTCGC CATAAAGTCC GAGAAGGACA     81480
     GGTTCGAGAT CGTTGCTCCC GAGGACGTCG GTGCCGTCGA TTGCGGCGAC ATAGTCGCGA     81540
     AGCATAACAG AACCGCCCTC GCCGTCAGTA GTTACCGCCG CCACGAAGCT GCCTCCATTC     81600
     ATAGGGTGCG TCCTGGTAGC CTGTCGCGCC GAGGGCATCG AACCAGCCCT CGAACGCGGC     81660
     AATCAACCCG GGGTCATCAA AGACATTGCG GCCGATGCCC TCCTTACACA GGGGACGCCC     81720
     GGTCGCATCG ACCAACTTTT TGGGAATGGG CGGCCCATAG CCGCCGAAAT AGACGAAATG     81780
     GTCGCTCACC AAAACGCGGT TAACGCTAGT GTCACGCGCC ACGTGCCGTG GATGACGCTC     81840
     GCCCGCATCG GTCGTGTGGA ATGAATCCCT CTGTAGCCAC TCATCGTCGG CGTCATTGCG     81900
     AAAATAGATG TTGTCGCCAC AGCTCTGTTT GCGACTTCCG TGCCGGTAAG GCTTCTTCTT     81960
     CGCGAAGCGT GGATCGGCAT CATAGTCTTG GAAGCTCAGC GCTCCGGTGA CGCGCAACGC     82020
     GTAGACAAGA TATCCGCCGC GCTTGATGCG GCGCTCGTTG CTGCCGCTTC CGACAACCCA     82080
     GTCACCGATC TGAGCCGCCT TACGGATATC AGGCTTGCAC GTCGCCAAGC TGCAATGACC     82140
     GTAGAAGGGA TTGGGCGCGA AACCACTGTC GTAGCGGACC ACGTACGAAT AAAGGCGCGG     82200
     CATCAGCAGG GATGCTTCTT GAGCGGAACC GTGTCGCAGG GACCACCGTC GGGTTTTTCC     82260
     CAACCATCCT TGCCGTTGAT CGCATCGATG ATCGCATCGC CGTTCCAGCC TACGACGGCG     82320
     TCAGCATATT CCTCGAGCGC CGACGGCAAT TCGCATTCCT TCTGGCCATG CTCCCAGACG     82380
     CCGACGATAC GCTTGCCCTG CTTGGCGGCA TATTCGATTT CCCAATTGAC CCAGTCGCTG     82440
     TCTTTTGTCT CTGGTGACAC ATAACAGATG AATACGCCCG CCCAATTGAT GGCGGGAGCT     82500
     AGTATCTGAG TCTTGATGTA ATTCTCGTCG GACGCATTGT TGAATTTGCC CGTGTGAATG     82560
     GACGAGTCCC GTATTCCCAT CCCTTTTGGC TCCAAGAGAT CTTTCAATTT CTTCAGCCCC     82620
     GCATCATCTT TGTGCACGTG ACTAATGAAG ACGTTTTTCG TCTCTGGCAT ATTATACCCC     82680
     TTGAGAGTCC ATCACTATTT AGAACAAGAA ATAGGTCAGA GGAAGATCTC GCTCGCGGAA     82740
     TCGAAACTAC AAATTGATCC TCTTTGGGCG GAGCAATCGG GCGCCGCATT GCAGTCTGCG     82800
     GGTTAAATGA GCACAACTTG TCTGTGCCGA TCTGCATTTG TCAAACCTCT TGAAGGCACC     82860
     GAGCTCTCAT GCCGCTTCCA GGAATTGATG AAGATCGGGG GCGCTTCCTG CAAATTCCTA     82920
     GCGGCGGCAG CCGTCAGCCC TACTATCGAA GGCTCCCCGT GGTGTACTAT GATGCACCAT     82980
     GGCTAACTAC GAACTACTCG TACTCGGATC ACCACCGCCG GGAACCGGCG ACATCCTCAC     83040
     TACGCGACTC ATGGAAGTCG CCGACCAGTT CGGCATGACG ATTCCAGACG ATCTCGCCGT     83100
     GCGCTCGGCC GCAGACGCGG GAAACCGGAA CGCCACGGCA TCGATCGCAG CACTCTACTT     83160
     CGGAGGTGAC CCTGCAGTGG ACGCAGGTCT CGTCGACGAG CTTGAGGCCG CCTGCGTCCC     83220
     GATCGTGCCT GTCGTCCCCG AGGGCGGGAA AGTGTCGACG ACGATCCCGG CCGAACTCCA     83280
     AGCTATCAAC GCCTTCTTTA TCGCCCCCTC GGATGCCGGT CTGTACGCGC TCGCCGCGCT     83340
     GGCGCTCGAG TGCCTCGGGC TACTCCGTCG GCAGCGGCGC GTATTCGTCA GCTACCGGCG     83400
     TGACGACTCC CGGACATTGG CGGTGCAATT GCACGACGAA CTCAGCGGAC GCGGCTTCGA     83460
     CGTCTTCCTC GACACGCACG ACATCCTACC CGGTGACGTC TTCCAGGAAC TGCTGTGGCA     83520
     TCGGCTGGCC GACTGCGACG TCGTTATCAT GCTCGACACC AAGGACTACT TCGGCAGCAA     83580
     GTGGACCAAG CAGGAACTCG GGCGAAGTTT GGCCCAAGGC ATCCAGATCC TGAGGGTCAT     83640
     CTGGCCGGGT CACACGCCAA CGCGCCATCT TAGCCTCAGC GACGCCATGC AACTGACCGA     83700
     TGCGGACTTC GACCCAGGGG GTCAGCTCGT CGCGCGCCGG ATAGACGAGG TCGTGCGGCG     83760
     TACGGAGAGC CTACGCAGCC GCAGCGTGGC GTCGCGCCAC CGTGAGATCG CTGGCTCGCT     83820
     GCGTGTCCAA GTCGAGCGGA TCGGCGGTAA ATTCGAGGGC ATAGGCGCCC ACCGCGCCAT     83880
     GGCACTCACG CTGCCGAACG GACTTGCGAT CCAGGCCTAC CCGGTGGTCG GTGTGCCGAC     83940
     GGCCGAGCTC CTGAACGACG TTCACGATAA AGCACTCGCA GCCAAGCACG GCCGGTTCCC     84000
     CTGCCTCGCG TATGACCACC ACGGCATCAG ACCGGCGTGG CGATCGCACC TCGAATGGCT     84060
     CGATAAGCAG GTCAAGGAGG TGCGCGCCCT CAGGGTGTTC GATGCAGCAT GGGAGCTCGC     84120
     CGAATGGGAC AGCTGAAAGC AAAGGCGGCG GTCTTCCTAT CCGCCGGAGT TCCCGATCCA     84180
     GCAGCCCCCC ACTTCCTCGG CGAAGGCGAC TCGGTGGCGA TCTCGGCAGC CGTCGCCGCG     84240
     CTCCTCGAGG TGACGCTCGG GCGGCGAAAG CTGGTCTGGG GAGGCCATCC CGCAATCACT     84300
     CCGATGGTGT GGGCCTTCGC GGAGTCGATG GGCGTGGACT ACGGCGAATG GGTGCTGCTC     84360
     TACCAAAGCC GCAGGTTCGA GGACGAGTTT CCTGAGGAGA CGGCCCTCTT CAGCAATGTT     84420
     GTGTTCACCG AGCGGGTCGG CACCGACATT AGCGCGAACC TCGCCTTCAT GCGCAGCCTA     84480
     ATGATCGAGG AAAACCAATT CGAGGCCGCA GTGTTCATCG GCGGCATGCA GGGAATCGTC     84540
     GACGAGTACC GCCTCTTCTC GGTTCGGGCA CCGAACGCGA TTATCCTGCC GGTGGCCTCG     84600
     ACCGGCGGCG CCGCACGCGT GCTGAACGAG ATGCTTGGCG GCGATCCCGC ACTGGCAGGA     84660
     AATCTCGATT ACGTGCAACT GCTGTATGAA AGGCTCGGTA TCGACCCGAA CGAGCAGCGA     84720
     TACGCCAAGC CCGCGGACCA GCCCGCCGAG GTCGCCGCGC GGATCGAGAT CCCGGGCCGA     84780
     TCCCGACGCT GAGCTAGAGG ATAGACCGCC CGAATGGTGG CATCCGACAC ACGCCGAACA     84840
     TGTCCCAGCA AAGGGCCAGC TCACGAAACG GAATTTTTCG CACGTAAATA TCACTCCAGG     84900
     ATCCTCGCCG CTTTCCCCAA CCGGCGTTCG GCATCGTTAT AATAGCGGGC GGCCTGCTGG     84960
     ATCGAGCGAT GCTGTGACTG CTGCATGGCT TCGGGCAGGG AGACCCCGGC CCTGCCCGCC     85020
     TCGGTGAGAT AGCCGGAGCG CAGCCCATGC GCGGAGAACA GTCTGGGGTC GAGCCCGGCC     85080
     TTGGCGCAGC GCTGCTTGAG GATCTGGTTG ACCGCCTGCG GGGTCAGGGC ACAAGGGGCG     85140
     ACATTGTCCC AGCAGTCGAT CGGCCGGAAC AGGGCGCCTT TGGTGATGGC AGCTACTTTC     85200
     ATCCAGGCGC GCAAGGCCTC GACCGGAGAG CCGACCAGCA GGACGCGGGC ATCCTCATCG     85260
     GCATCGCTGG TCTTTGTGCG ACCGAGTTGA ATCGACAGGC AGGGCAGGCG GGGAGACATG     85320
     GGGTCCAGGG GATCCGCCGG CACGGGCGCT TCCTCGTGCA GCTGCTCGAC GCGCAGACCC     85380
     GCCACTTCGC TGCGCCGCCG CCCGCCCGAG GCGAAGGCTA CAAGAAGCAA AGCCCGATCG     85440
     CGGAGATCGA CCAGCCTCCC GCCATGGCAG GTCTTCAACA GTTCGGTGAG CACATCCTTG     85500
     GTGACCGCCT TGGCGCTCTT GCGCTGGCGC GGCCGCGGAT TAGCCCGCAC GGCGAGCCGC     85560
     CAGGCCGAGC GCAGGGTGGG GGAGGTAAAC GGTCCCTCGA GACCGCGCCA GCGGTGCAGA     85620
     GTGCGCCAGC TGGCGAGCCG CCGCTCGACC GTCGCGGGCG CATGCGGCCC TTCGACCCGC     85680
     AGCTGTCCAG AAGCGCGCAA GGCTGCAGAC ACTCCCTCCG GCATGCCGTG CTCGGGATCG     85740
     ATCTCGCGCC GGATCGGATC CCACAGATGA TGCGCCAGGA ATTTCAGGAC CAGGGCTTCG     85800
     GGGACCGGCC ACGGCAGGGG AGAGCCCGTC GCCGCCTGCG CCCAGGCTTC GAGATAGGCA     85860
     CAATCGGAGG CGAGCGCCCG CAGGGTGTTG GCGCCCATCC CGATCTCGAC GAGATGCTTG     85920
     AGGGTCGCGA CATCCTCGTC GGTCAGCTGG GTGGCCAGGC CCTCCCGCCG CTCGCCGGGC     85980
     AGGATCGACG CCAGAGCATC GAGCCGCGGA ACTGTCCCGG CCTCGAGAGG TTTTTCCGGC     86040
     AAGGGCAGGG CGGATTTTCT CATGAGGACG CCAAAGGCCC GAGCACCGGC ACCTCCTCGG     86100
     CTCTCGCGGC CGCGGCGAGC TTCTGATCGG TGGTTGCCAG GGGAAGGGTC TGCGCCAGCG     86160
     CCAGCGCGAG ATAGCTGGCA TCATAGCCGG ACAGACTACG GCGCTGCGCC AGGGAGAGGA     86220
     CAAAGGCATC CTGATCGACA GGTTCCTCCC GCAGCGGCAG GGCGCGCAGC TGTTGCATGG     86280
     AGAGGAGCGC TTCGCCCGCC CGCAGACGCC CACGCCGTTC CGCCGTCAGG AACAGATTGC     86340
     GCGTCTCGAA CCAGAACAGG CCGGGAACGC AGCCAGCCTC TTTGCCGAGA GCGGCCATCA     86400
     CTTGATCGGA GGCCTCCGAC TGTTCATCCG GCAGGAACCA GGCGGCGGCG ATCGAGGCAT     86460
     CGACGACGAA GACCATCAGA AACGCCGGCC TTCGTCGCGC CAGGCGTGGA TTTCCTCGGG     86520
     GGTGGTTTTC GCCCGATGCG CGCGGGCGGC CTTGATTTCG GCGATCACCG TCTCGACGCT     86580
     TTTTTCCGGC CGAAAGCGCG TCAGCCGGGC AATCGGCTCG GGGCCGCGGG CGATGATCAC     86640
     CTCCTCACCG GCCTCGACTT TGGCGAGGAG GTCGGACAGA TGGGTCTTGG CTTCCCCGAT     86700
     CTTGACGGTG ATGGTCATGA AAAATCCTCT CCGGAGAGAC GTTCGATGGT CCGGATTTAC     86760
     GAGGACAACC GCTATTTAGT CAAGGCTTGA CCAAATGATT AACGATAAGG GGACCTTATC     86820
     ACATGTTTGA TGTGCGCGCT AGAAAAGCCG CAAGTGATGG AAGTTAAGCT TAATATCACT     86880
     TCCATTTATA AAACTATATG ATAATTTATC AATGGTTTAG TTATTAATTA AAAGGTGCGC     86940
     TTCAATTCTT TCCCGAAAAA GATCGCAGTT TTGCCCTTCC GCTTCCTGCT TTCAGCGCAT     87000
     ACGGAGCACC CCTCCATGGC CAATCCGCGT GCTACCCATC CGTTTGTTCT CCGGGCCGAC     87060
     AAGACGATGA AGCGCGAAGC CTCGGCCGGC GCCCTGGGTC GACGTCACGC GTTCCCCCTC     87120
     AATCAGGCGA TCGAATTTTC TTCCAACGCC AATACCTGGC CAAGCGCGGC CTCCAGGCAG     87180
     GCGTGGCGAC TGGCCGAGAC GGCCGCACTG TTCCGGCTGA GGAGGTCTTC GCCGGCCTTT     87240
     GGCCGCGGTG AAGACCCTTC GCCGAGCCCG TTGCCCGCGA TTGAATCCCT TAATCGATTG     87300
     CCGCATCGAA GGAAGGACAC ATGATGGATT GGCAGACCTT GCCCTGGCCG CAGCTCATCG     87360
     GCCCGCTCAT CGCGGCTGAA GATGCTTTGG CGCGCCTCGA CAGTCGCCTC GCCGCTAGCC     87420
     CGATCCGCGA CGGCTGGATC GCCCGCATGG ATGTCCTGGA GGCTTGCGCC AGTATCAGTC     87480
     TCGATGGCGG CCTCGTCGAC CTCGCCGATC TCGTCCTGCG CGACGCGAAC ATGGACAGCG     87540
     CGCCTTCGAG CGAGGTTTTG ACCCGGGCGG AACAGGTTCT TGCCGCGCGC CGCCGCATCG     87600
     CCAAAGCCCG GCCGCGCTGG GCTTTGAGCC CCGAGGGGCT GGCCAGCCTG ACGGGGCGGT     87660
     CAGGGGATCC AGAGCGGGTC TCGCAGACGG AGAGCCGGGA CGGGGAAGGC GATAGGGAAG     87720
     CAGGGCAGGG GGACGAGACG GAGGAGGTCT GGGCCAGTCC GTTCGCCGCG CTCGATGCGG     87780
     CGATGGCCCG GGTCACCCAG CGCCTGGCCC AAGTGGAGGC CGGCCTCAAG CCGGTTTTAT     87840
     CAGCGACGGC GGCCGACAGG GTGCTGGCAC CCTGGCTTGC GGTCCAAAAA ACCACGGAGG     87900
     CGTGTCCGCC GACGCTCGCC GCGGCGATCG CCTATGAAGC CTGGGTGGAC CTGCGCCCCT     87960
     TGCCGCAACA GGACTGGCTC GGCCGCCTGC TGGCCGCATC CTCGCTGCGG TGCCGGGGCA     88020
     AGACGGAAAC CCATCTCGTC TGTTTCAATG TCGGCTTGCG GGCCTTGCCG CCGCTCCTGA     88080
     TCCGGCCAAA AATTACGGCG GATCGGCTCG CCCGTACGCT CGACGCCTTC ACTGCTGCCG     88140
     CCCGCAAGGG CCTGGTCGAT CACGACCGCT GGCTCACCGC CCGGGAGCTT TTCCTGCGCA     88200
     AGACCGAGGG GCGCCGCTCG ACCTCGCATC TCGCCGCCCT CGTTGATCTC GTTCTCCGCC     88260
     GGCCCGTGGT GTCGAGCGAT CTCATCGCGA AAGAATTGAA GATCACGCCG CGTGCCGCCC     88320
     AGACCCTCGT GGCGACACTC GGATTGCGTG AACTAACGGG GCGGGGGCGG TATCGCGCCT     88380
     GGGGGATCGT GTAGGGGAGG GTGTCGATTT GAAGATAGAT CTGGGCGGCA TGGCACGCCA     88440
     TTTACATGAG CCCGTTTAGA GCGGAAGGAA CTGATCCTCT CGTTCTTGAA GAAGACCGTG     88500
     TGGAGGACAT CATCAATGCC CGATGGCAGC ATGCCAGCGT ATACGCTGGC GCCCGTCGCC     88560
     ATGGTCCGCT CTGCTATGCT GGATGGACAC CTACACAACC AAATCATTCC AACCAGATTG     88620
     GCTGCGTAGC TGATGCGTTA ACTTGATTTG ATGTGTTAAC ATGAAAATTT TTGGTTGCTT     88680
     TCCGCTTTAA ACAGGTAATC ATCCAGCATC GCGGGGCGAT TGCACGGTAA ATCAACAAAA     88740
     CATTTCTGTT TCACTCAAGT AACAGGGGCT AATTCTTACG GTTGTCAGCA ACCCGACACA     88800
     AAACTTGCGG CACACCCCAA AACCTTACGC TGCAAAGTCT CATTGTATCT CTGCCTTGCG     88860
     ATTAGCTAGC TTAACATCCA TATGAGCAAG TATATCTTCA GCGATTTTGG ACGCACCATG     88920
     CATAATATTA CGATCTAGAT CGTGTCCTGC AAAAAAATAC TTCGCTGCGG CAGCATAGGG     88980
     ATGAGGCGTA ATGATCGCGC CAGGTAACTT TCCGCTAGAA GCGTCGATTT GCATTTTATA     89040
     CACTTCCGTA GACACTTTAT TCCTTGAAAG GTCTGAGAGG TTGATTTCTA CCTGCAAATG     89100
     CGTATGACCC GCACCGAAAC CGATGATCGC CCGCTGTAGC CTATTGCCTT CATTGATCTG     89160
     TAAAAAAGTA CCGCTAACCA GCAGGCCATT CTTAGGCAAA GGCGTCCCAG CGGGCAACCG     89220
     ATAAGCTTCC ATTCCTTTAT TGGTAAGATC GTTGACGATT GCATTGCTCA TCAGACTGGG     89280
     TAAAGACTTG GCTTTTGCTT GCTCCATGAA AGTATGTACC TGCAAATTAG AGAAAAGACT     89340
     TTCTGATTTA ATACTGTTTG GCTGTAGTTC AAAATCGATA ACGTAAATGA CTTGGTGCTG     89400
     AAATTTGACT TTTGTCGGGA GACTATAAGC TCGGACATTT TCCGCCCCCA AACACGCCGC     89460
     GCCAAAACCA GCCAATATTA ACACGCTGTA TCTCGTTCCG TGATAGATTG ATCTCGCAAA     89520
     TGTTTTTGTG GTCATCTTGA ACTCCGTGTG TTTGTTTATA AAGGTGATAA GTTACAGAGG     89580
     TATTTTGATT AAAAATACTC AGAAGATTAC TCCGAGCCAG ATATACGCGG ACAAGCGTAG     89640
     CCCTCGGCTT TCCCATATAG GTAGCAAAAT GCACGGGCCG CTTTTTAGGG CCGCGTGCTA     89700
     ACTCTTCCAG TTTTCAGATT TTGTTAGCTT TCGGAAGTTT AAGACCGACG ATAAGCTGAT     89760
     CGCTTTATTG ACAACCGATA AAGTAGACGC CTTTGCGATC ATTTACTTTG GCAAAGCATT     89820
     TGCGCCAGGG GCCTTTGTCA AAGCCTTCTG GCAGGCTGAT GTCAGTTCTC CCAAGTGGCT     89880
     CTGCAGACAA GTCAGGATCC TCCCGCCGCC AGGCTGCACT CCGGAACAAA GCCGCGTGTA     89940
     ATCTCCGCGG CAGATTTGTT GTAAAGCCTG TGCTTGGGCC GGCATCTGTG CCAGAGCTGC     90000
     ATTTGGTCTT GCCGCAAAAA CGGCCAACAG AGCTGCCGCG GTGATAAAGG GCCGATGGTT     90060
     GAGTGTGATC ATGACGTTTA TTCTCCTGCA ATAATGCAAC TGGATGTGGG GCTGGTTGTG     90120
     ACTTCTGCTC CCCTGTCGTG GGTTGAGGAG CGCCAAGAGG GAGCTGATCC GGGTGGCGAG     90180
     AAAAGCACAC GGAGCTTGGC TATGAATGAG GGAGCGTGCT TCAGGTCGTG AGCGAGTGTC     90240
     ACCCATTCAT CAAAGGCGGT GTGAAAGGGA TTGAGGGTCC GCGCGCTGCC ATGGAGGCCA     90300
     TAGCGCAGGG CTTCGTCCGT TGGCGCCTCG GCAAAGGTGC CGAATAAGCG GTCAAAAAGG     90360
     ATCAGGACGC CTCCATAATT TTTATCGAGG CAGGAGGAGT TTGAGGCATG GTGCACGCGA     90420
     TGATGCGCCG GTGTATTCAG CACCCATTCG AGCGGTCCGA GCCGCGGCGC AAGCTCTGTA     90480
     TGAATGAAGA ACTGATAGAG AAGATTGCTG CCGAGCATTG CGGCAATAGC AACGGGATGG     90540
     AAGCCGATCC AGGCGAGAGG GAGGAAGAAC AGGAAATTGC CGGATAGGTT GCTCGTCCAC     90600
     CCAAGCCGGA TAGCGGCCGT CAGATTGATT TTGGTCGGTG AGTGATGCAC GGCATGTGTC     90660
     GCCCACATCC AGCGGATGCG ATGCGCGCAG CGATGCTGCC AATAATATTG GAATTCAGTT     90720
     GCAAGGAAGA GAATGCCGAT GCTGATCGAA GTCGTTGATG CGAAATCGAT GAGCCGATGA     90780
     TCATAGACAA AAATGAAAGG CATGCTGATG AGGCCCGCTT CGAGCGGGCG GATCAGGTTG     90840
     TTGCCAACCG CTATGCACAA TGACGAAGCG CTTTCGGCAA GGTCATGGGT CGCCTTTTCA     90900
     CGATGTGCGA GGCGACTCAC CAAATATTCC AAAACCATAA AGCTCAAAGC GGTCACGGGG     90960
     ACTAACAGGC GCATGGCCGG ATAATTTGTC AAGGTCAGGT AAGTTAGCAT GGCAGTGCTC     91020
     TTCTTCGGCC ACTATGCTGC AAAGAATAGT CATGCTCTGT CAGCCCCGTT TGAATCGGGC     91080
     GCATCCTTTT GTGGCATTTT GTCGATGCAA TGTAACGGTT TGTAAAATTC CATCCAGGCC     91140
     CTTGATTCTT CGCGCCGAAT ACTTGACAAA ACGGAGATGG AAACGAACAT GACCACACTT     91200
     CTGATTGTCG AAGACGATCC GGATATTCGT CAGCTGATCG GCGAATTGAT GCGCAATGAA     91260
     GGCTTCCATA TCGAGGAAGC AGAGAATGCT GCCGCCATGG ACGCGACCAT GACCCGCATA     91320
     CGGCCCGATC TCTTGATCCT CGATCTGATG CTTCCCGGTG AAGACGGCTT GTCAATATGC     91380
     CGTCGCATCC GGACCCATAG CATAATGCCG ATCCTGATGC TGACGGCCAA AAGCGACGAG     91440
     ATCGACCGGG TCGTTGGGCT CGAAATGGGT GCCGACGATT ATCTGGTAAA ACCTTTTGGG     91500
     CCACGTGAAC TCCTTGCCCG TGTTCGTGCC CTGCTTCGAC GAGCGGCAGC CCTGTCACCT     91560
     GTCATGTCAT CGCGGCGTTT CGCCTTCGAC CGATTCATTA TTGACCTGGA CGCACGGCAG     91620
     GTAACCGACG ACAAAGGCTT GGCACTTACA TTCACCAGCG CAGAATTCGA TCTTCTCGCC     91680
     TGCTTTGTGC AAAGACCCCG CCGGGTACTC ACACGTGATC AGATTCTCAA CCAGATACGT     91740
     GGGCGCATCA CGGATCCATT CGATCGCACA GTCGACATGC TGATCTCACG CATTCGGCGG     91800
     AAGCTCGATG CGGCATGCCC TGGCTCCAAT TTGATCAGCA CGATACGCAA CGGAGGCTAT     91860
     CTTTTCACAG CTCCTGTCAA ACCGGCACCG CAATGCTCCG GCTGAGCCTT GCTGCTCGCC     91920
     TCTCGATGAT TGTCATCATT GTCCTGATGG CCGTCTGGCT TGCGGCATTG GCCAGTTTCT     91980
     ATCGATCACG CTTGTCGAGC GATCAATATA CGCAACCCAA AGCGCAGCAA ATTGCGGCCA     92040
     TAGTAAATCT CGTCGAAGGC GTGCACCCTG AACAAAGGCC TTTGATCCTT GATGCTGTCA     92100
     CATCGAGTAT TCTAGAGATC AAGCTGGAAA CTGGGCAAAC GCAAATGCGA CAAAAGCCAG     92160
     CCAGTTTGCC TAACCAGCAG CTTTTCGATA ATGCTCTGTT ACAGAATTAC ATAGATGCGT     92220
     TGGGTGAGCA CCCTTTCACG ATCACCTCGG TACGCAAGAC CACAGAGAAA TGGCGCTTGC     92280
     TGCGCTTTTC CTGGATGATT CCGAATGCGC TGGAATTTCG GATCACCTTG AAAACAGGCG     92340
     ATCTCTTGAT AATCGATGCA CAAAGCCCTC TAGCCATGAC CCGGCTTGGC TGGCCGGTCG     92400
     GTTTTGGCGC CGGCTTGCTT GGAACCTTAG TTGCTCTTGT CGCACTCATC CTCATGTATC     92460
     GGGAAACACG GCCTCTGTCA CGTCTTGCTG CCGCCGTGGA CCGTATGGAT CTGATCGACA     92520
     CACCTGTGGT CCTACCCAAG GCACGCACCT CGGCATTGGA AGTCCAGGCG CTTATTGCGG     92580
     CTTTCAACCG ACTGCAGAAC CGTCTGGCGC AACTCCTGCG CGCCCGTATG GCGATGCTCG     92640
     GAGGCATTTC GCACGACGTT CGCACCTTCG CGACACGACT GCGCCTGCGG GTCGAACAGA     92700
     TCCCGGAGGG CACGGAACGG GATCGGGCAA TCGGGGATAT TGCAGATATG ATCCGTCTTC     92760
     TGGATGATGC GCTTCTCGCA AGCCGCGCCG GAGCCGGCGA ATTCTCAGAA GAGCTTGTCG     92820
     AATTGGACCA AATCGTGCGT TCCGAAGTTG AGGACAGGAA AGCGGCGGGC GCCTCAATTG     92880
     ACCTTTCTAT CAGCAGGGGC GCGGTTGGCA TTCCCGTTCT GGGCGACCGC CTGGCACTTC     92940
     GGCGTATTGT TTCGAACCTT GCCGATAATG CCTTGCAATA TGGTCATAGC GCGTATCTCA     93000
     CTGTCGAGAT CGAGGCGCAA ACACTTGTCC TGAGCGTAGA CGACGAAGGA GCTGGCATTC     93060
     CATCTGAACT ATCCGAGATC CTTCTTGAAC CCTTCGTGAG ACTGGAGACT TCACGCAATC     93120
     GGCGCACAGG TGGCGCAGGC CTCGGACTTG CCATTGTTCG AACACTTATT GAGGCCCATA     93180
     GCGGAACGAT CTCTATTGGT GCGGCTCCAA CGGGAGGTGC TCGATTCATC GTACGGCTGC     93240
     CGATATTCAC CGTATCCTCA ATAAAATCAA AGTATTGATG ATAGGCCGGA TGGACAAAAT     93300
     CAGCCGTTGA CTGTTTGGGA ACAGACCGCC GTTGATACAA ATTGTTACAT GGTATTGACA     93360
     AGACACCAAA AACACATATG CCCAGATCAA ACGGCAATGA CATTGCAATG GCATTCTCCT     93420
     TAGCACGGCT TCCAATTTAA GCGGTGTGGC ATGTATTCAT AAAGGAGCTC TCCATGAGGT     93480
     GAGAAAACCT GAAGATGGGG GAAACCTTGA ATCAGGATGA GTATGCCTAT CAATGCAATG     93540
     TGGAGATTAA TATCAGATGG GATCCATGAA ACCAGAGCCA CAGTGCTGCC AATATATTTT     93600
     TACTCTCGTT GCTAGCAGCT TCATATGCGT CTTAAGCTGG GGACTGTCAG CTCACGGGGA     93660
     CGCAGCCATT CAATTTCGCA CAATGCCTGA ACCAGTAGCC ACATTCGATA CGACTGATAG     93720
     GGTTCGAGGC ATTTGTATGC CTGAAATCTA TGCTTACCTC GACATCGAAA ACCTTGCCGA     93780
     GGCTCTCGGT CCAGATGGTG CTATCGTCGT TGATGCCCTT GAAGACCTTG GCAAACAGGT     93840
     CCACGATTGC CTAAGTATGC AGTTTTCCGA TAATTTCGAG CTCTTTCCCT GGTTCTCAAA     93900
     CATAGAAGCT TCGACGCACA GGCAGGAACG CCAGCAGAAG ATACAAGATC AGAACGTGTG     93960
     ACTCCCATCT ATTCCTGGAA ACAGGCGGGT TTTGGAGTGA ATTCCTTCAC GCATTCCCAG     94020
     AAAATCAGAT CAGTCTCAAA GCCGGTGCTT AACTTTAAGT CCAAAGTTCC AAAGAATCCA     94080
     AATTCGCAGA CCATTAACAG GAACACCTGG AGAATGGTCG TCTAGCAGTC ACAATGACAA     94140
     TATGGAATCG GAATTTACGA AATGAAACAT GTCTTTTATG CGATAAGCAT ATTGATGTGC     94200
     AGCATTGCTT TTGCCCCTAA CCAAGCCAAT GCTGTTGTCT GTGCGCGGGG TGTCTACAGA     94260
     GCAGGATGCA TAGGGCCGCA TGGCTCCGTC GGTGTGCGAC GTACAGTTGT CGTCCACCAC     94320
     CCAATCGCGG TTCCCCGCAC TGTTGTGATT AGGCGGTCGG TTTATCCACG CTAGGGTCGG     94380
     ATTGATCCGA AAAGTGGGTA ACCACTTTTC GGTTTGCTCG TCTATCACTA CTTTGGCAAA     94440
     ATTTTGAATT TGCTTTGCTG TTGGGGTTCA CTGGCGCTAA TTTCCTGATT CAAGGGTAAC     94500
     CGCTTTGCGG AGCGGCTACC CTTGAAGGAC GACATCACGC TCTGAGATGC TTTTATCTCC     94560
     CTTTGGCACA GAAGCTATTT CAGAATTGGG TGCTTTCTGA CGGATGTTCT CGAATTTTGG     94620
     GCCATGACGT TGCACATACA TAAATTCGAG AATAAGACCG AGAGGAGTTC AAATGCCTCA     94680
     CGATATGAAA GCATCGAATG TTCAAATGAA TGCAAACCTA AGGCTCAAAA CTATCGCTTA     94740
     TGCGTCGAAG CACGAAACCG AGAGTTTCAA AAGGCTAAAC GATATCGCCA GCCGGCCATC     94800
     GCCAGCCAAC GGACGCATAA TATTTCTTGA GCTGCTCGAC GATAGCGATC GAGGTTCCGC     94860
     GGATCGGCTT GTTGAGCCCG TCTCGTAAGC CGGTCACGAC ACGGATACCA CCGCCTACAG     94920
     CCAGAGTAAC AACATGCGCC GTGGCAAGAG CGGCTCCGCC TGGCACGATG AGGCCTGGCA     94980
     TGAATCCACT ATCGCTCGAC GTCTTGAACG CAGTCATCGA ATGAACCGGA GCTGAATCGT     95040
     CATTCACAAA GTCAGCTTTC GCCTGTAATT CGGCTCGACC AACACCAAAA CCAATGACCA     95100
     GCCGCGTAAC AGGATTGCCT TTATCGGCTT TCATAATCGC GACATGGAGG ATGGCGGCGC     95160
     CGGGATGCCG TATTCCCGGC ACAAAGGGTT CAGTCGTAAG TTTTGCCTCC TGTAGCCTTT     95220
     TGATAAGATC TGCCTTGAGT TTGGTGGCAA CCTCCTCGGC AAGTTTCATC TCGGAGGTAT     95280
     TTGGGACCGG GACGACATCC ACATCGACTA GAATCTGCGC CGGCTGTGGA CCTGTAACTT     95340
     TTGTTGAGGC AATATTGGTG ATCTGTGCAC CAGCACACCC GCCAAGTAGT GTCATAATCA     95400
     AGCTTATTGC GGTAACCTGC GGCAATAAGC AAAGACGCCT AGGATTCCAC CAGTCTGCGC     95460
     CCGGCATGCC AAAGCTGTTG GCAATGTCTG AGTGTCTATC CATCACCTTT TGCATATGAT     95520
     CTCACTGCTC GGTCGGAGGC AGGGCCTGAA CGGCCTAAGA AGATGCTAGA GTATCGGATA     95580
     TTCAAATTGG CTTGCTGCGA TACTCCATAT TTTGAAAACG CATCGCTTTT TAGAACAGCC     95640
     GGTGCGTACT TATTTGAGCG ATGCTTCAGC TTCAGTAATG GCTTTATCGC CTAACCCAAA     95700
     ACGAGCTGCT TCTACTGGCT TTAATGCTAT TAATTTTATA AAAGCACCGC TTTTTCGAGG     95760
     TATGGGTGGA ACTGTCAGCG ATACAGAAAA GCATCTGTAT CAACGCACAT AGATAACGCG     95820
     TGGAGTCGTA TAAACGACCG GAGGCGTAAC ATAGACAACT CGCGGAGGCG CATAAACAAC     95880
     CGGCGGAGGA TAAGCAGGCT TAGATGCGGC TGCACCGATG GCTGCTCCTG CCGCTAGCCC     95940
     TGTGATAGCT CCGGCGGCAA CGGCTCCTCC TCCATAACAG CAGCCATGAT ACCCCTGATA     96000
     TACGCCAGGA TGGCCCCATA CGGCGCCACC GTGTCCCCAG GCAGCCCATC CCCCGGCCTT     96060
     AGCCGGAGAG TCGATAAGGC AGGCCGCGCC GGTAGCCAGC AAAGATGCCA GGATAAGTTT     96120
     ACGAACCATT GACTAAACTC CTCAGCAATC GATAGTGTCA ACATCCTACG AGATTGTTAT     96180
     GCGGTTGAAT TAGCACCTGC GGCGCAACCA CTATCGCGAT CCATTCCGAT CATTTATTAT     96240
     CACTATAGCC TCGTGGACTT TGGCTATTGC AAAGAATATA GTTAAACCTT GTCAGCACAG     96300
     TTTGATCTTG GCGCATCATT TTATGGCATT TTGTCTGTGG CTTGTAACAG ATTGTAAAAA     96360
     GCACAAATCT GAGGAGACAA AACCCTGTCA TCTGGCATCG CGTTGAAAAT AAAATGGTAG     96420
     CTCGAATAAA CCCTGATAGC TGCGATCGCG GGTGTGTCGC ATACTTTGTA TGCGGTAGTA     96480
     GAAGTATTCG GGAACCAAGA AAGCCAAGTC TTTAGACTTA TCACAGTACA AGTAGGAAAT     96540
     TTTAATATCA GCGTCGGTGG GAAAATCGTG GATGGTGTTC CACGAATTGG TACAGCTTTT     96600
     ATTCCAAATT AAGCTCGATC AAGAAACATG ACATAGGCAT GATGCCACTG AATGATCTAG     96660
     AGCGCACCGT CCTAGGGTCA GGACTCAAAT AAATCAGATC CAGAAGGCTA CGGTGGCGAC     96720
     GAGGCAGAGT GCGGACAAGA AATTTTGTGC GAGTTTGTCA TACCGTGTGG CAATCCGCCT     96780
     GAAGTCCTTC AGACGGCAGA AACAGCGCTC AACGACATTG CGTCCTTTGT AAGCCTGTTT     96840
     GTCGTGGCGA ATTTTCTTCT TGCGGTTTGA CTTGCTGGGG ATTGTGGCCT TGATGCCGTG     96900
     CTCTTTGAGA AAGGTTCGTA TGGCATCTGT ATCGTAACCT TTATCAGCCA AAAGTTCTTT     96960
     GATACCCGGA ACGAGGCTGA CGCAGGCCTC GGCCATTACA CAGTCGGCGG TATTACCTGG     97020
     CGTGAGGATG AACGCCCAGG GACGGCAGAA CGGGTCGACG ATCGCGTGGA TTTTGCTGTT     97080
     GCGGCCGCCT TTCGTGAGGC CGATCGCCTG CGCTTCAGCC CCCCTTGTCC GCCGGCCGCA     97140
     CAGCGGTGGA CTTTCACATG CGTGCTGTCC AACGCGGCCT GTTCTGGGGC TTCCTCGGGA     97200
     GCGGCCGCAT GCTCGAAAAT CTTTTGCCAG ATGCCGCGTT CGCTCCAGCG GACAAAGCGA     97260
     TTGTAAACCG TCTTGAAGGG GCCATACTCT TTCGGGCAAT CTTTCCAGCG GCAGCCCGCT     97320
     GTCAACACAT GCATGATCCC GCTCAAGATA CGCCGATCAT CCCCGCGCTG AGGCCCCGGC     97380
     TGGTTCGTCG GCAAATGCGG GACGATCTTC GCCCATTGTT CGTCTCTGAA CCAGAATAAA     97440
     TTCGTATCCA TTGGCCTCCA CCCTAGACCA AGCCATTGAA TCAAAATAGG GTTAATCGGG     97500
     TCTTAACCCT AATTGCGATG TGTGACGTCA ATCCAGAGAA CTCTTCCGCC CTTCGAAGCC     97560
     AAATAAGTAG GGCAATGGCT AAGAACCGAA GAAACACTGG CCACGGGTTT TTTACGGATC     97620
     TCGCAACAGC AGAGACTTCG CAACGCATCA AAACAAGGCA AATATATTCT ACGGAACCCG     97680
     GTTTAGATGC GGAAATAGAA GGCTTTCTAG ACCCGATGTT GTTTGTACTT TTATAGATGA     97740
     GGATGGTGTT ATCTAATCAT TAGAAGGTGC AGCGACCAGA GATGATACAA CTAATATCAA     97800
     CTTTTCTGAA GTAGCATTCA AACTAATATA ACTCACTTAA TATGTAAGTT ACTTATGAAT     97860
     ACCACTTATT ATAGATAAAT TGAACATTAT CGGATGTTTT ATCATCCAAC AAGCGCGGCG     97920
     ATTAAGCCGC CTTTTTGATG ATAAACCGCC GTCTTGGTCT AGGCTTCGCG CATGGCTTTG     97980
     TCCGACGATT TTCCGCCTCC GCCGCCCGCC TGCCCCGTTG TTCCCGCCTG GGCACGCAGG     98040
     GCCGATGTGC CGGAAACCCC TTTAGCGGCT GGGGTTTGCC GCCGGAGCGG CGCTCGCCGC     98100
     GCTCGATCCG ATCGCCCGCA CCACGCATCC GCTCGGCCAG CTCCTGCGCC GTCTGACCCT     98160
     CGCCCAGGCG GCGCGGCTGC TGCGCCTGGT GGGGCGGGCG GAAGAGGAAC CCGCCTTGCG     98220
     CGATGCCTGG GTGCTGCGCC GCGCCGGCGA TGATCCCGGT CCGGCCGGGC GGGTCCTCGG     98280
     CCTTTGGCGC GCGCTCGGCG AGCCGTCCGC CTTGCCGGAC ACAGGATGGA CGGAGAGGGT     98340
     GGCGAGGCTA TTCGACCTCG GGGGCGACGA GCGGCTCGAG GCGATCCTTG CCCTGGTCCT     98400
     GAAACAGAGG GCAGGGGAAG GGAGTGCCGT GACGGACGCC GCCGCCATCG CCACGGCCAG     98460
     CCTGCGCCTC ATGCCGGACG CCATCCTCCT GGCGTTGTGG CTGGCCGATG CCATGCTCGC     98520
     GCATCGCCTG CACTGGCCCG CGCCCATGCC CCTGCTCGCC GCTCCGATCC GGCCAGCCGA     98580
     GCTGCACGCC ATCGCGCGCT CCGGCAAGAG CGGGGACGGC TGGTTGCTTG TCTGCAGCCA     98640
     GGCTTATGCG CGTGCGGCGG CAGCGGCCGT GGATCTTTAT GCGGACCTCC TCCCGCGCGC     98700
     CCATCGCCTG CTCGCCGTGG CGCCGCGGCT GCGCGGCAAG GATGCCGCGC ATTTGGTCCG     98760
     GCTTCTCCTC AGCGAGGATG CACTGGCGGC CGCGGCCGGA CCGCAAGGCA GCGATCGTAG     98820
     TGCCCGCCGT CTGTTCGATC GGCTGGTCGC CCTCGGCACC GTGCGCGAGC TCACCGGCCG     98880
     CGCGGCCTTC CGGCTCTATG GGTTGTAGCC ATGGCGAAAC GGTCCCGCTC CGATACCGCC     98940
     CTCGATCGCG AGCTCGAGGA CCTGCCACCG CCTTTGCGCT GGCGGGAATG GATGCGGCGC     99000
     GTCGAAGCCC TGTTGTTTGC CGCCAGCGAG CCAGTCTCGC GCGAGGTGCT CGCGCGGGTC     99060
     GTCGGCGTAT CCTGCGCGAT CGAAGCCCTG ATCGGCGATT TGCGCGCGGA TCTGCGCGGC     99120
     CGCCCCTATG ACGTCGTCGC GGTCAATGGC GGCTGGCAGT TGCGCACCCG GCCCGCGCTC     99180
     GCCCCCGTGC TGCGCGCGGC AGGGTTCCTC AAGAAGGGGG AGGGGGACTT CAGTCCGAAG     99240
     GAGGCGCTCC TGTTGCTCGC CATCGGTCAT TTCCAGCCGA TCACCCCCGC GCGTCTGGGG     99300
     GAATTCTTTG GCCGCGAGAT CAGCCGCGAT ACGCTCGCCT GGCTGTGCGC CCAAAAATGG     99360
     ACCGGATCCG GCCCGCGCAG CCCCGAGCCG GGGGCGCCGA TCACCTATGT CACGACACGG     99420
     GAATTCTTGG AGCAGTTCGG CTTCGCCAGC CTCGCCGATC TGCCGGGGCA GGGGCTGTTT     99480
     GCTGGCGCCT GGACGGACGG AGAAGAAGCA TTCGGGCCTT TATTACCACA GCCGGATGAC     99540
     AATAATCAAA ATGAAGAAAA ACTTTATCCG CAGTAGAGTA GAGCATAGAG ATTTTGTGAG     99600
     CATACGGGGT AATTTGAGAT ATTAGGATTA TATCACTGGT TATTTCGTAG AAAAGCTACA     99660
     AACCTTGATC GTTTGAAAAG GCTACAAGCA TGGTCACTCC CGAGGCAATG AACCTATTTC     99720
     ACGATATTAT TACACACGAA ATGTTTGAGA TGAATCGGAT ACTCGAGGAA GTTCAACAAG     99780
     TAACATTATC AAATTTAGCT TCACGGGGAT TAACGCAATC TGGCCCAGCA ATGCAGCTCG     99840
     TAATCCAAAA TGCTACGAAT TCCCTCAAAA CGCGGGCACA ATTTATTCTT GGTCAATTGC     99900
     TACGTTGTTT GGCTTCTTTC CATGTTCCAC TAGATAAAGA GACAATTACA GAAGCATTAT     99960
     CACTCTTACG GGATACGATA GAAATGCAAG CGGACGACAT AGGGAGACGA GTTTACCAAT    100020
     ATCCAGTTTT TTCAATCCGT GGCTTAGAAC AAGCAAAGCA TCAGCTGCAG GCACAATATG    100080
     CCCAAGAAGG ACCGAGATTG ATTGATCGGC TTAGTGCCGA ACTGAAACTT GCTGCTGCAG    100140
     CTTCACAGAA TTCGCGCCCA CAAGGCGCAC CTAGTTTTAC GTTTCATGGC CCTATCGGAC    100200
     TCGTTCAAAC TGGAGACGGC AGTCAAGCTA CAGTTCGCCA GCATATCAAC ACTGACGTGA    100260
     AAAATCAGAT TACTACTGCA TTGCAGCTCT TTTTGGATCA ATTGGATATG CCGGATAGCA    100320
     ACTCCATTGG TAACCGAACG GAACTACGCG AGCTGATTGC GGAGGCAAAA GCTGAAGTGG    100380
     AAAAACCGGA ATGTAATACC TTAAAGCTCG GATCCAGTTT GCGTACAATC GCAGAGACCA    100440
     CGAAATTTGT TGGTTCACTA GCCCCAGCCT ATTCCGTCTT GAAGCCCCTA ATCAGCTATT    100500
     TAGGGATACA TCTTCCTTAG TGCTGTCATT TCAATTGAGA CGTTTTCAAC CTTTGCAACA    100560
     GCCCACGGCT CGCATGGTCG GCATCGATCC AGCGACGCTA AAGACGGGCA CTTAATGGAA    100620
     AAAATAACTT CGATGTGGTC TGCATTAGCC AGTTTTCTTC TTGGTGTTCT TGGGTGGGTA    100680
     GTTCCAAAAC TCCTCATCGA ACCGGGCAAG GAGATTTTCG ATCTTCGTCG GGAAACACAG    100740
     GAGAGTTTAA TCATCTATGG CGATTTGCCA AAAGATGCCC CAGCAGACGA GAGACGCTTA    100800
     GCTGCGGAAA TATTCGAGAC CGGCAAAAAG CGGGGGGTCA GGCTGCTTTA AAAGGCCTGT    100860
     CGTTAGGCAA GGTCAATTCT GTGGGTCGTG AAATACCGCA TACACGTTCA AGGTTGCCGT    100920
     TGAAATAGGC GGTGCGATTA TGCAGCATCA GCTGAGCACC CCAGCGAGAC CACCGCATCT    100980
     GGCGTTTCTT GCACATGCGG TGATTGATGA GCTGATTGAC GGTGGACTCG ATATGGGCCG    101040
     TAGATATCGG CTCCCCGTGA TGCCAAGCAC GACCATAATC CACCAATGAT CTGATATTTC    101100
     CGCGAGTATA ATGTTCGAGG TCCTGGAACC GTTTGTAGGC TTCTCTGATC CGTGTCGGAT    101160
     CGCCACCCGC GCCTTGAGTT GCATGGTGGC AAAGGATTTG CGCACCCAAA TGCGATAGAG    101220
     CGATCAGCCA TCGGCCATGA CGGATCGGCC GTGGTGCCAG AGGTTCCGCC TGACACTGTG    101280
     CAAAGAGCGT TGGTAAGTGG CTCGCAGGGT CTGGCTATCG GGATCGGCAT AATCGATCGT    101340
     CCAGGAAAGG TTTCTGCCGA GCCATTCCAT TCTCCGCCGC AGATGAAACC AGTCGAGCCG    101400
     ATGTTCGATC TGACCTGCGC CTTGGCGCTG GACCTGACCG TTCAGCCATT GGCCAGCCAT    101460
     CAGCCGCATG GCATCCTCCC CGTCAGACAG AATAGTCAGC CTTGTGGCTG GTCCGCGTCC    101520
     CGCTGTACGA AGGGCTGAAC GCACCCGTTC GCGTGCATGA GCGTCAAGAT CGCGAACCGC    101580
     GGCAAAGACT TTGGGCGATT GTTCAAGCGG TTCGATCTTG CCAAGGACGA TTTCGAAATG    101640
     CCGGCGTTGA TTTTTCGAGC TTACCGCCCG GACAAAAGCG CCATCGATCC CAACAGTCAT    101700
     CTGCTCAACA GGCTTTTCGG CAAGCGGCCT GGTGGCGATT TCTGCTTGTA TTTCCTCTTC    101760
     GATCACCTTT CCGATCGCCA CGACGCGATT GCGGGTGGTC GCCGCATTGA ATGAGCCAAT    101820
     ATCCGGCAGG AATTCGTTGA GGATAGCGGC AGCTTGCCGA TAGGAATAGA TGCTGCCCAG    101880
     CTTGGCTTGC AGATACCGTA ATTCAGGCGT TGAGCGATGA GGGAAAAGAG CCCCAACCGG    101940
     AGAGGCGGCA TTGGAAGCCC CACAACGGCA GTCTTCATAG CGGGGAGCAT GCAGGCGCAA    102000
     GTGACCAAAA ATCGTATCGA CTTTGCGGCG CCGATGATCT TTGATGGGTC ACGCACGATC    102060
     ACAGCTGCTG CAAATCCGTG CCTTTGCGAT GAAAGCCTGA ACCTGATCGC AGGTGACCTC    102120
     CGTCTGGATT TGACGGATCA GATATTTGCC GTCCTCATGC GTGAGGCCGA GGTCGGCTTC    102180
     GGAGGCCAAT TCCGGACGCT CGATATGGCC AATGGCCCTC GACTGGAGAA CCCCTTCCTC    102240
     ATCTATGCGC TCAAGCTTCA AGGTCCATTG CATCGGAAAC TCCGCGATAA TCATCTCTCA    102300
     AAAATAGCGG AGTTTCCCCT AGCGACCCCC AGCTTTTTGC CGGTCTCGGT TTTCTGCTTC    102360
     ATTCCTGTCA TGGAGGCAAA TTCTCACGGT TATCGGCAAT CCGACAGCCA TACGTTCTTT    102420
     TCGGTCCAGG CTGATTGAAA CTGGCGCAGG ATATCCTTGC TTTCCTTGAG GGTGGGCCCG    102480
     AAATCCTCGG CCGTCGCCGT TGCAAACTGC CGCTCCAGCT GACCGACTTC GTACTCGATC    102540
     ACCTCACCCC AACCGGTTGT CGCCTCCAGC TTGATCCGCC CCTGCATGAC TTTCCTTCCC    102600
     CTCGGGAAAG CCAATCATGC ATCAGCAGAA CTGTTGCCCT AACTTTTTTT CCCCATAATG    102660
     ACCCGGCAGG AGGCTTGACA TATTCATAAA TCAGAGTGAT TTAATATAAC CAAAGATAGA    102720
     TATAAATAAC TTTTGAGGGA ACGCCATGAG ACTGAGGGGC ATTCTGCTCG GCGCTTGCGC    102780
     CGCCTTGACT TTGGCCGGAC CGGCTGGAGC GGAAACGCTG ACGATTGCCA CCGTGAACAA    102840
     CGGTGACATA ATCCGGATGC AGAAGCTGAC GGATGATTTC AAGGCCAAGA ATCCGGACAT    102900
     CGACCTGAAA TGGGTTACGC TCGAAGAAAA TGTGTTGCGG CAAAAGGTGA CGACCGATAT    102960
     CGCGACCAAG GGCGGCCAAT TCGACATTAT GACCATCGGC AATTACGAGG TGCCGATCTG    103020
     GGCGAAACGC GGCTGGCTGC TGCCGCTCGA TAATCTTGGC GCGAATTATG ACGAGGCCGA    103080
     CTTGCTGCCG TCGATCAGGG AGGCGGTGTC CAGCGGCGGC AAGCTCTATG CCTCGCCCTT    103140
     CTATGGCGAA AGCGCCATGG TCATGTATCG CACGGATCTG TTTGCCAAGG TGGGCCTGAC    103200
     GATGCCGGCC GATCCGACCT GGGATTTCAT CGCCGAGGCG GCGCGCAAGA TCACCGACAA    103260
     GAATGCCTCG GTCTATGGCA TCTGCTTGCG CGGCAAGGCG GGGTGGGGCG AAAACATGGC    103320
     CTTCCTCACG GCGCTTGCCA ATTCCATGGG GGGCCGTTGG TTCGATGAGC AGTGGAAGCC    103380
     GCAATTCGAT CAGCCGGAAT GGAAAAACGC TGTCGATTAT TACGTCAAGC TGATGAAGGA    103440
     TGCCGGCCCG CCCGGAGCCT CCTCCAATGG CTTCAACGAG AACCTTGCGC TCTTCCAGAC    103500
     CGGCAAATGC GGTATTTGGA TCGATGCGAC AGTCGCGGCC TCTTTTGTCT CCAATCCCAA    103560
     GGATTCCACG GTTGCGGACA AAGTCGGATA CGCTCTGTTT CCTACCTCCG GCACATTCGA    103620
     TAATCATGGC AATTGGCTGT GGGCCTGGAG CCTGGCCGTG CCCGCTGGAA CCAAGAAGGA    103680
     TAAAGCGGCG CAGAAGTTCA TCACCTGGGC GACCGACAAG GCCTATATAG AACTCGTCGC    103740
     CAGCAAGGAC GGATGGGCGA ATGTGCCGCC CGGCACGCGC GCCTCGCTTT ATGACAATCC    103800
     GCACTATCAG CAGGCCGCGC CTTTCGCCAG CCTGACGCTT GCGGCGATCA AGGCCGCCAA    103860
     TACCGCTAAA CCTGCCGTCA AGCCTGTGCC TTACATAGGC GGACAATTCG TGGCCATTCC    103920
     GGAATTCCAG GGCATTGGCA CGGCGGTCGG CCAGCAATTC TCGGCTGCTC TTGCCGGTCA    103980
     GGTGACCACC GACCAGGCGC TTCGGAGCGC CCAGCAATTG GTTACCCGGG AAATGACCAA    104040
     AGCGGGCTAT ATCAAGTAAG CTTTCGAAGC ATCTGGCTTG GACGGGCAGA AAACCCATGT    104100
     TCCCGTGCTG CCGGCCTGAA ACCGGCAGCA CCTCCGCCGC GTGCGAGCTC GATGCAATGC    104160
     CGATCCGTTC AATCTACCCA AGGTTCGCCA TGGCGACGTT ACACACCCGT TCGGCCGCGC    104220
     GTCTGATGAT GGCGCCCTCC GTTCTCCTCC TGCTGGCCTG GATGATCATC CCGCTGGCCA    104280
     TGACCATCTA CTTTTCCTTC CTGCGCTACA ATCTGCTGAT GCCGGGCACG GAGGAATTCG    104340
     CGGGTCTCGC CAATTATCAA TATTTCTTGA CGGATCCGGC TTTTTTCACG GCTCTCGCGA    104400
     ATACATTGTT GATCGTCGGC GGAGTGCTTC TGATCACGGT GATTGGCGGG ATCGCCCTCG    104460
     CATTGCTGCT CGATCAACCG ATGTATGGGC AGGGCATCGT GCGCATTCTG GTGATCGCGC    104520
     CATTCTTCGT GATGCCGACG GTCTCCGCGC TCGTCTGGAA GAACATGTTC ATGAATCCGG    104580
     TGAACGGCCT GTTCGCCTGG ATCGCCGGTA GCTTTGGGCT GCAACCAATC GACTGGCTGG    104640
     CGAGCGTGCC CTTGTTGTCG ATCATCATCA TCATCGCCTG GCAATGGCTG CCCTTTTCCA    104700
     CCTTGATCCT GCTGACAGCG CTTCAGTCCC TCAATGAAGA GCAGAAGGAG GCGGCGGAAA    104760
     TGGATGGCGC CGGCGCGATC TCGACATTCA TTTACATCGT CCTGCCGCAT ATGGCGCGTG    104820
     CCATTACCGT CGTCGTCCTC ATTCAGACGA TCTTCCTTCT CTCGGTCTTC GCCGAGATCC    104880
     TCGTCACCAC CAATGGCGGG CCTGGGGTGC AAAGCACCAA TCTCACCTTT CTGGTCTATA    104940
     CGCAGGCTCT TCTTCAATTC GATATCGGCG GCGCATCGGC GGGCGGCATC GTCGCTGTCG    105000
     TGCTCGCCAA TATCGTCGCT GTCTTTCTGA TCCGCCTCAT CGGCAAAAAC CTGGAGGCTT    105060
     GAACATGGCG CGCCGCTATT CAGCTCGCCG CGAACTGGCC ATGACCATCA TCGCATGGAC    105120
     AGTTGGGCTT GCGATCTTTT TCCCCATTCT CTGGACCGTG CTGACGAGCT TCAAGACGGA    105180
     AGCCGAAGCT GTTGCTTCCC CGCCTTCCTT CCTGTTTTTT CATTGGACGA CCGAAAATTA    105240
     TGCCGAGGTC CAGAGCCGCT CGAACTATCT GGCTCATTTC ATGAACTCGG CTGTTATTTC    105300
     GCTTGGCTCG ACCCTGGCCG CATTGGTGAT CGCCATTCCC GCCGCATGGG CCATGGCCTT    105360
     CTCGCCCACC AAGCGGACCA AGGACGTGTT GATGTGGATG CTCTCCACCA AGATGATGCC    105420
     GCCGGTCGGC GCACTCATTC CGGTCTATCT CATTTTTCGC GATACCGGCC TGCTCGACAC    105480
     ACGCCCGGGC CTCGTCATCG TGCTGACATT GATCAACCTG CCGATCGTCA CCTGGATGCT    105540
     CTACACCTAT TTCAAGGAGA TTCCGGGTGA GATCCTCGAG GCGGCGCGCA TGGATGGGGC    105600
     CTCGCTCCTC AAGGAGATCG TCTATGTCCT GACGCCGATG GCCGTGCCGG GCATTGCCTC    105660
     GACGCTTCTG CTCAACGTGA TTCTGGCCTG GAACGAAGCA TTCTGGACAT TGAATCTGAC    105720
     AACCTCGGAA GCTGCGCCGC TGACGGCTTT CATCGCTTCC TATTCGAGCC CCGAGGGCCT    105780
     CTTCTACGGC AAGCTGTCGG CGGCATCCAC CATGGCCATC GCACCGATCC TGATCCTTGG    105840
     CTGGTTTTCG CAAAAACAAC TCGTTCGGGG TCTCACCTTC GGCGCCGTCA AATAGGAAGA    105900
     GCCCCATGGG CAGTATCTCA CTTCAGAAAG TTGCCAAACA TTTCGGCCCC TTGAAGGTCA    105960
     TTCCCTCGAT CGATCTTGAA ATCAACGATG GTGAATTCGT GGTCTTCGTC GGCCCTTCGG    106020
     GCTGTGGCAA ATCCACGCTC CTGCGGCTCA TCGCCGGGCT GGAGGATGTC AGCAGCGGCA    106080
     AGATCGTCAT CGATGGCAAG GATGCGACCT ACGCACCCCC GTCTCAGAGG GGGCTTGCCA    106140
     TGGTGTTTCA ATCCTACGCG CTCTATCCGC ACATGAGTGT GCGTTCCAAC ATCGCCTTCC    106200
     CGCTGAAAAT GGCGGGCATG GCGAAGGAAG AGATCGACCG CAAGGTGAAC GACGCGGCCC    106260
     GCGTCCTCAA TCTTACCGAT TATCTCGACC GTAAGCCGCG CCAGCTTTCG GGAGGCCAGC    106320
     GCCAGCGCGT GGCCATCGGC CGGGCCATCG TTCGCCAGCC ATCGGCCTTC CTGTTTGATG    106380
     AGCCGCTCTC GAATCTCGAC GCCGCTTTGC GCGTCAATAT GCGCCTGGAG ATCAGCGAAC    106440
     TGCACCAGAC GCTGAAGACC ACGATGATCT ATGTCACGCA TGATCAGGTG GAAGCCATGA    106500
     CGATGGCGGA CAAGATCGTG GTGCTCAATC GCGGTCATAT CGAACAGGTC GGATCGCCTT    106560
     TGGAGCTTTA CCGTAAGCCG GCCAATCTGT TCGTCGCGAG CTTTATCGGA TCGCCGAAGA    106620
     TGAATTTGAT CGGCGGTGCC TATGCGAGAT CCAAACATGC GGCAACGGTG GGAATAAGGC    106680
     CCGAGCATAT CAAATTGTCG CGCCAGGGCG GTGTATGGAG CGGCACCGTC AGCGTGGTGG    106740
     AACATCTCGG CTCGGATACG TTCTTTCACA TCGATGTCGA TGGCATCGGT CCCGTCACGG    106800
     CGCGAACGGA TGGTGACTTC GACGCCCACC ACGACGACCG GCTCTTCCTC ATTCCGGATG    106860
     AGACCAAGCT TTACCGCTTC AATGAAGAGG GCGTCGCTCT ATAGGAGTCA TTCGCCCGAA    106920
     TGAAAGACAA AATTCTCCAG ATGAACCGGC GGCTCTCCAT CGCGCCGTTC CGGTTCCCAA    106980
     CTATGTGAGG ACCGAGATAT GACAGGCAAG CTCTCGCTCG CGGCATTGAA CGAGATCGCG    107040
     GCACCGACGG CGGTTCCCAC CTATGCGCGC GAAAGCCTCT CCGCCGGCAT TGTGCATTTC    107100
     GGCGTCGGCA ATTTTCACCG TGCGCATCAG GCGGTCTATC TTGACGAATT GTTCAATGCC    107160
     GGTCAAGATC TTGACTGGGC CATCATCGGC GCGGGCGTCA TGCCTTCCGA TGCGCTGATC    107220
     CGTGAAAAGC TGCTCGCGCA GGATTGCCTG ACGACGATTG TCGAGCAGGA CAATAACCGG    107280
     ACCGCCGCCC GCGTCACGGG GGCGATGATC GATATTTTGC CGACCGGCGA TGCGGCGGCG    107340
     ATCATCGAGA GGCTGGCCGA GCCGGCGATC CGCATCGTCT CCATGACCAT TACCGAAGGC    107400
     GGCTATTACC TCGACGCGAA TGGCGCTTTC AACCCGAAGC ATCCGGCGAT CGTCGAGGAT    107460
     GGCCGTCATC CCGAGGCGCC GCGAACGGTG TTCGGGCTGA TCGTCGCCGG CCTCAAGGCC    107520
     CGCAGGGAGA AAGGCATCGA GCCCTTCACG GTTCTGTCTT GCGACAACAT TCCGCATAAC    107580
     GGCAAAGTCA CCTATAACGC GGTCACGGGA CTCGCGCGGC TCGCCGATCC TGATTTCGCC    107640
     AACTGGATCG CCGCGAATGT CTCTTTTCCC AATTCCATGG TCGACCGCAT CACGCCGGCG    107700
     ACAGGCCAGC GTGAGATTGA TATTGCCCGT GAAGATTTTG GCATTGAGGA CAATTGGCCG    107760
     GTCTTCTGCG AAGAATTTCG GCAATGGGTG ATCGAGGATA AATTTCCTGC GGGGCGTCCG    107820
     GCTTTGGAGA AAGTGGGCGT CCAATTCGTC CTCGATGTTT CGCCCTACGA ACTCATGAAG    107880
     ATCCGTATTC TCAACGGCGG CCATGCGGCT ATCGCTTATC CCGCGGCCCT GCTTGACATT    107940
     CATTTCGTTC ACGAAGCGAT GGAAGAGCCG CTCATCCGCT CCTTTCTCGC CAAGCTCGAA    108000
     CGCGAGGAAA TCATTCCGGT CGTTCCACCC GTGCCGGATA CCGATATCGA CGCCTATTTC    108060
     CAGTTGATCG AGCGGCGTTT CTCCAATTCG AAGATCGGTG ACACGATCCC CCGTCTGGCG    108120
     CAGGATGGTT CCAATCGGCA GCCGAAATTC ATTTTGCCGA CGACGAAAGA CCGGCTGGCG    108180
     CGTGGCGACG ACGTCATCGG CCTTTCGCTG GTCTCCGCAC TCTGGTGTCG TTATTTCGCG    108240
     GGAACATCGG ATAGCGGCAA AGACATTGTC TTCAACGATG CGAGCGCCGA GCGGCTGCAT    108300
     GCGGCTGCGC TCGAAGCGAA AACAGACCCA TCGGCCTTTC TCGCCCTCGA AGATATTTTC    108360
     GGCACCATCG GCCATTCGGA ACTGTTTGCC CGACGTTTCT CTCACGCCCT CAAGACATTG    108420
     TGGGAGAAGG GAACGCGCGA GACGCTGACG CTTTATCTAG GGTTAAGACC TAATCAACCC    108480
     TATTTTGATT CAATGGCTTG GTCTAGGGTG GAGGCCAAGT CGATGGATAC GAATTTATTC    108540
     TGGTTCAGTG ACAAACAATG GGCGAAGATC GTCCCGCATT TGCCGACGAA CCAGCCAGGG    108600
     CCTCAGCGTG GGGATGATCG CCGTATCTTG AGCGGGATCA TGCATGTGTT GACAGCGGGC    108660
     TGCCGCTGGA AAGATTGTCC GAAGGAGTAT GGTCCCTTCA AGACGGTTTA CAATCGCTTT    108720
     GTCCGCTGGA GCGAACGCGG CATTTGGCAG AAGATTTTCG CGCATGCGGC CGCTCCCGAG    108780
     GCAGCCCCAG AACAGGCCGC GTTGGACAGC ACGCATGTGA AACTCCACCG CTGTGCGGCC    108840
     GGTGGACAAG GGGGGCTGAA GCGCAGGCGA TCGGCCTCAC GAAGGGCGGC CGTAACAGCA    108900
     AAATCCACGC GATCGTCGAC CAGTTCTGCC GTCCCTGGGC GTTCATCCTC ACGCCAGGTA    108960
     ATACCGCCGA CTGTGTAATG GCCGAGGCCT GCGTCAGCCT CGTTCCGGGT ATCAAGGAAC    109020
     TTTTGGCTGA TAAAGGTTAC GATACAGATG CCATACGAAC CTTTCTCAAA GAGCACGGCA    109080
     TCAAGGCCAC AATCCCCAGC AAGTCAAACC GCAAGAAGAA AATCCGCCAC GACAAACAGG    109140
     CTTACAAAGG ACGCAATGTC GTTGAGCGCT GTTTCTGCCG TCTGAAGGAC TTCAGGCGGA    109200
     TTGCCACACG GTATGACAAA CTCGCACAGA ACTTCTTTTC TGCACTCTGC CTCGTCGCTA    109260
     CCGTAGCTTA TTGGATCTGA TTTATTTGAG TCCTGACCCT AGAAAACCGC CTAATCGAAG    109320
     AAGTTGAAGC TCAGATCTAT CCGCAGGAAC ATGAAATCCT CGATATGCTC AAAAGCCATC    109380
     GTGTGGAAGA AGCACGGCCA CTTCTGGCCG TCTGGCTGGC CGAGCAGCGT GACCGCGGGA    109440
     CAATCGTTCT GGACGATGTT CATAGCGGCG CCCGTATGCT GATTGACATG ATCTTTAGCG    109500
     CGATAACTCC TAAACCGGAC GACGAATGGC CTGATCGTGA TGCCCGGCAG GCGCATATTC    109560
     ACCGGTGCAT CGGCATCTTT CTCAATGGTG TGCTTCAGCG GGCACATTGA GTATCAGGAC    109620
     CGTATATCTG AAGGTCAAAC CCAAAAGCAG CTCTCACCTT TAGAAGCAAT CTGTATTTTC    109680
     GGACCTGTCG CAAACTGTAC ATGTATCCGT AAAGATACCT CAGATTATTT GAGATGCCTT    109740
     TGTCCGAGCC CGTCTTACCT CATCCCTCAT CGGCCCCAAC ACAAGAGTCC TCAAAGGCGC    109800
     TCTCATCCGG GTCCCAATGC TGTCAGGAAT GATCATTATG AAGTCAGTCT TTGAGAGGCA    109860
     AAATCGGTAT TGCCCCCATC CCCTCTTGCA AAGCGGGCCA CCTAATGCCT TAAAAACGGG    109920
     TCCATCAGTG CAGCTACGGC GTCGAGACGT TCTGCTGGCC AGCGTAGGAT CTCTAGTCGC    109980
     CTACGGCATT GCCGGAGCCG CTCCATCGAT CGAGACGGCG ACCAGTCCAG ACGTTGCTAG    110040
     ATTTATGGAT ATCTCACATT CCTTGACAGA CCGCTCTAAG CTTGATCCGC GGATCGGAGC    110100
     CGCGCTTTAT GCGGGAATCG TCAACTCGGC GCCTGAGCGG AAGGCCCAGC TTACCAAGCT    110160
     TCACGCCCTC ATGAACACTG GGCGCCTGAC CACCTCGGCT GACCTTGCCA AAACCGCCGA    110220
     AAAGGTTGAT CCGGCCCTGA AGGACGTGAT CCATGACATC ATGACCGGCT GGTACCGGGG    110280
     TGTCGCAGAT GGTAAGGTCG TGGTTTACCG ATCCGCCCTG ATGTTCGACA TCACGAAGGA    110340
     CGCCATCTAC CCCAAAACCT ATGCCGCTGG CGGTCCATTC TACTGGACAA CCCAGCCGCC    110400
     CGAAGTCGCT CAGCCGTCCG GGCAGCCTGT GCTTTCGCCG TCCTCGTTCG TCGTGGAACC    110460
     CACCTGAAAA ATCCGGGACA CTCTCATTCA TGTCTTCCGA TCAGAATGTT TCTGCCGATG    110520
     TCGTGATCGT CGGCTCCGGT GTCGCGGGCA GCTCCATTGC TAATGAATTG GCGCGGGCCG    110580
     GAATTTCCGT CATCGTTCTT GAAGCTGGCC CCCGCGTGGA CCGTCAGCAT TTCGTTGAGA    110640
     ACTTTCGTAA CCTTGAGAAC AAGCCGTCCT ATCAGGGGCC GTTCCCGTCC ACACCCTGGG    110700
     CTCCGCATCC GCCGAACCAG ATGACGCCCA ACCAATACCT GCATACGACG GGTCCAAATG    110760
     CCGAGGCCTA TCAGCAGGTC TATCTTCGAA TGATCGGCGG TACGACGTGG CACTGGGCCG    110820
     GATGTGCCTG GCGCTTTCTC CCCTCCGATT TCGAACTCAA GACCCGTTAC GGGCAGGGGC    110880
     GCGACTGGGC GCTGAAATAC GATGACCTCG AGCCGTTCTA TTACCAGGCT GAGGTTATGA    110940
     TGGGTGTCTG CGGACCGGAC CCTAAGATTG AGGATCTTGG CTCTCCGCGT AAGCAGCCCT    111000
     ACCCCATGTC GGCGCTGCCC ATTTCCTACG CCGCGCAGCA GTTCCGCAAG CTCATCAGCA    111060
     AGCAGACGCC ATGGCGCATC GTGCATGAGC CACAGGCCCG CAATACGCAG CCCTATGACG    111120
     GGCGTCCCAC CTGCGAAGGC CATAACAACT GCATGCCGAT CTGCCCGATC GGAGCCATGT    111180
     ATAACGGCAG CTATTCCGTC TATCACGCAG AGGCCGCCGG GGCGACGTTC ATCCCCAATG    111240
     CTGTCGCCTA CAGGATCGAG CGTGATGCCG CCAACAGGAA AGTGACGGCG GTTCACTATT    111300
     ACGATCCGGA TAAAGGGTCG CACCGCGTCG CGGGAAAGTA TTTCGTCATT GCCGCGCACT    111360
     GCATCGAGAC GGCGAAGCTG CTTCTCGTCT CGGCGGATGA CAAGAGCCCA GACGGTGTTG    111420
     CGAATAGCTC GAGCCATGTC GGCCGGAACA TGATGGACCA TACCGGGGTG CAAGTCACGT    111480
     TCATCAGTGG CGATAAAGCG CTCTGGCCCG GTCGTGGCCC GCTTTTGACG AACGTGATCG    111540
     ACACCTTTCG CGACGGCGAT TGGCGTGGGG AGCACGGCGC CTATCTGGTG CATATGGTGG    111600
     ACGATAACCA AGTGGACCTC GCGACGCAGC TCGCGATCTC CAAGGGGTAT GTCGGACACG    111660
     ATCTGGAAGA ACAGATCCGC TATCTGGCCT CCCATACCGT TCGTCTGTTC AGCCATAACG    111720
     AGGCCTTGCC GGATCCCGAC AACCGCCTGA CCCTCAGCAA GACGCACAAG GACGCGCTCG    111780
     GTATCCCGCA TCCGGAAGTC TATTATAAGC TGCCAGACTA TACGGTGCGA AGCTGCGAGC    111840
     ATACGCGTGG TGTGTTCAGG CAACTCATCG GTCTTATGCA CGGAACCGAT GAGCAATGGA    111900
     CGCCGGGATA TTTCCCGCAG GACCATCCCT CTGGAAGTAC CATCATGGGC GCGGACCCCA    111960
     GGGATTCCGT GGTGGATGGC CATTGCCGGA CGCACGACCA TGAGAATCTG TTCATCGCAA    112020
     GCTCGTCTGT CTTCTCAACG GTCGGGACGG GCAACATCAC CCTGACAGTA GCCGCCCTCG    112080
     CGCTTCGTGT TGCTGATATG CTGAAAAGAG AACTACGCCA TGCCTGATAT CAAAAGTGCT    112140
     GCTTTCTGGT CTTTTCTCAT CAGCGGGGCA TTTCTGGGCG GGACTGGCGC GCATACGGCA    112200
     CGTGCGGCGG ACAACGATCA GGACCTCATG TCCCGGGGCG CCTATCTGGC GACCGCAGCC    112260
     GACTGCGTCG CCTGTCATAC CCGTCCCAGT GGCCAGCCGT TTGCTGGCGG CCTGAAGGTT    112320
     TCAACGCCCC AAGGGGACGT GGTTTCCACG AATATTACGC CGGACCGCGA ACATGGCATC    112380
     GGAGACTATA CGGAAGCCGA TTTTGAAAAG GCTCTCCGTC GCGGTATCCG CAAGGACGGA    112440
     ACCTATCTCT ATCCTGTCAT GCCCTACGTG TCCTATGCAG GACTTACGGA TCAGGATGTG    112500
     AGGGCGCTAT ATATTTGGTT CATGCATGGT GTGCATCCGG TCGCGGAAAA GCCGCTTGAG    112560
     ACGCAGCTGC GCTTCCCCGC CAACATCCGC ATGGCCATGG GGGTGTGGAA CCTGCTAGCA    112620
     GGAAGAGAGA AGCAGGAAAC AGGAGACTCT TTCCAATATG ATAAGCTGCG TCGCGGGCGT    112680
     TACCTAGCGA CGGCGCTCGA ACATTGCGGG ACCTGCCATA CGCCGCGCAA TTTCATGCTC    112740
     ATCGAAAAAC AGGACCAGTA TCTTGGCGGT GGCGCCCTGG CCGGATGGTA CGCACCCAAC    112800
     ATCACGTCGA GTAAAAGCGG CGGGATCGGG GATTGGAGCG AGGAAGACCT GGTGTCCTAT    112860
     TTCAAGACCG GGCGCGCGAA AGGACGGAGC CAAGCAGCCG GTCCAATGGG AGAGGTGGTC    112920
     GAACACAGCA CCAGTCACCT GACGGACGAG GACCTAGATG CGCTGGCCGC GTTCATCAAG    112980
     CAGGTTCCGG CCCGTCATAA TGAGGGGGTT CATCAGGCAC GTGACAGCTT CGGTAAGCCG    113040
     GTCGATACCC CGGACCTGCG TACGGGCGAA CTGACACGGA TTGACGACCT GAGCGAAAGG    113100
     AGCGGAGCCG AAATTTATGA CGGCAACTGC GCAGCCTGCC ATGGACAGAA CGGAGCCGGG    113160
     ACGGCAGACA ACTATGTTCC GTCGCTCTAT GCCAATTCTG TCGTCGGGTC GGAGCGTCCT    113220
     GACAATCTCA TCATGACAAT TATCTATGGC GTGGATCGCA CGACCCCATC CGGCCATGCC    113280
     AGCATGCCGG GATTTGGTCG CAATTCCGAT GTACAATGTT TGAGCAATGA GGAAATTGCG    113340
     CGTTTGGTGA ATTATGTGAC CGCTACGTTC GGGAACCACG ACCATCATGT GACGGCCGAG    113400
     CAGGTCGCTG CCACCAGAAC GGATCACCTT GAAAAGATGG TCTCTCATGT CTCAGTCAAA    113460
     ACCACGGCCG GGAGCGATCA GCGGTGATGG AGAGCATGTA AAACCATGGG GGACATTAGG    113520
     CTGCGAGGGG CTGTCGCAAA ATTTTTGATA AGGCGCGCGA AGGGCATACG GTACGTTGTT    113580
     TTCAGGCTTT GTTAAGCTGT TGAAGACCCA AACAGCGTGC AAGCAGGTTA TTTTGCTCAC    113640
     GAACGGTCCA ATCGCAGGCA AAGCCAAATC CTTTGCGTAG CCACAGCATG GCCTCGAATC    113700
     CCTTGATCGT CTGCCGCGCC GTGGCGAAGG ATTGGAAACA ACCCACCTTC GGCATGTTCT    113760
     GCTTCACCCG GAAATGATCA CTTTCGATCC CTTGCTGGAG ATGTTTGGCC ACTCGATGAA    113820
     CCGGATTTGG CCGGAGCAAG CCTTCCTCTT CGGTGGCCTT GATCGCTGGC GGGAAGGTCT    113880
     TGGCGCCATC GGTGCCGATC CTGTCCGGAG CCAATAAGGG CTCATCTTTC AGCATCTTGC    113940
     GGAAGAACCG CTTGGCCGAG GCCAAATCAC GCTTGGCGGT CAAAAGGAAA TCGACCGGGT    114000
     TTCCATGCTT GCCGATCGCC CGGTACAAAT AACGCCACTG GCCCTTGATT TTGATGTAGG    114060
     TTTCATCGAT GCGGATCGAG CCGCAGTGCG GCTTGCGGAA GAACCGTAAT CTCTTCTCGA    114120
     TCTGGGGCGC ATAGGCCAGT GTCCAACGGT TCAGAGTGCT ATGGTCGACC TCGAAACCGC    114180
     GTTCGAGAAA CATTTCTTCG ATATTCCGGT AACTGAGTGG ATAGCGCAGA TACCAGGAGA    114240
     CCGCCTGAAG GATCAGCCAA GCCTCGAAAT GACGGCCCTT GAAATCGTCC TTGGACTGGC    114300
     GCTTGAATTT CTCGACAAGG GTATTGAGGA TCTCGGCAAT CTCCACAAAT GGGAGCCGCA    114360
     AGTTCCTCCT TTTTCCTCAA GGGTTTCTTA AGCCCAAAAA ATTGGCGACA CCCCGTAGTT    114420
     CATTGGCAGC CGCTTTGTGC GGCTGCCGGC TCTCTTGTTT GCGTTCCTTG GCCACGGTTA    114480
     CTCCTCCCGT TTCATTCCGT CAAATTAGAC ATACACTTGT TACTAACGCT TGCGCTGACC    114540
     ACTGCCATCA AGATCGCTGC TGGTTCCGCA CCATCCAATC ACCGCTACTC TAAATCGATC    114600
     CCGCATTTCA CTAAGCATTT GTAACAAGTG TGTTATCTTT CGCGAGAACA TGCCGAGAAT    114660
     CCAAGACTTT CAGGCCCTCT AGTCGGCAAG CGTTTAAGGG TTTGAAGCAA TGTTATGACG    114720
     GCGCAGGGTA AGCTCATTCG TGTTTACAGT GAATGCGCCA TCGATGAGCA TAACGGTTTC    114780
     CATTCTCTGC CTCGGCCTCG GATCGTCAAC GAAAACTGCG ATACGACCAT TGGAATTGCC    114840
     GTTATTCTTG ACAGCATAAA CTAAAGCCAT CTCGATAGCG ATCGTATAAC GGCGTCTGCG    114900
     ATAGCGTCAG CTGTGATGCC GAAATGCTTG TAAAGATCTT TACTTGGTGC CGACGCACCG    114960
     AAAGATGACA TGCCGACGAA AAGCCCATCT TCCCCAACAA CAGCGTCCCA CCCGAAACGG    115020
     ACAGCTGCCT CAACCGCAAT GCGGATCGGC GCACTGCCTA TGAGAGCCTT CCGGACCTCT    115080
     TGTGGCTGAG CGAGGAAGAG TTCTAATGAA GGAATCGAAA CTACGCGAGC AGCAATACCT    115140
     TCGGCAGCGA GCAGTTTATA TGCATCTACC GCAATCTCGA CTTCCGATCC GGATGCAAAA    115200
     ATCGTTACTT GCGGCTCTTC GCCTTCGCTT ACCATCAGCT CGTAAGCGCC AGTTGCAAGA    115260
     AGGTTTCCAG CACTATGTAC CGTTCTGAGT TGTGGAAGGT TTTGCCGTGT CAGCACGATC    115320
     ACGGTTGGAC CGTCGGTGCG CGATAATGCC AACTCCCATG CCTCGGCTGT CTCGATCGCA    115380
     TCGCATGGGC GAAACAGCCG GAGATTGGGA ATAGCACGCA ACGCCGCGAG GTGTTCAACG    115440
     GGCTGGTGAG TTGGCCCATC CTCTCCAAGA CCGATCGAAT CATGCGTCAT TACATAAACG    115500
     ACCGGTGCCC TCATCAATGC GGAAAGACGG ATTGCGGGGC GGCAATAATC GGAGAAAACG    115560
     AAGAAAGTGC CACCGACGGG GACGAGACCG CCATGCAAGA CCATGCCATT CATAGCAGCC    115620
     GCCATGCCAT GCTCACGTAT ACCGTAATGG ATATAGCGGC CTTCCCACGA GTCCGGCGTA    115680
     ATCGACTCGA ATCCCTTGGC CTTAGTGTTG TTCGAAGGCG TCAGATCCGC AGAACCGGAG    115740
     ATCAGTTCCG GCATGATAGG AAAGATTGCC TCGAGCGCCA GTTCTGAGGC TTTACGTGTC    115800
     GCGACAGTCA CAGGATTTGC ATGTAGCTTT TTTTTGTGTG CCTCGATAGC TTGTGAAAGA    115860
     CTGGCCGGTC TGGTACCTGC GGTACGTCGT ACGAATTCGA CACGCTTGTC GCTATCGAGT    115920
     GCTGCGAGCC TCGCAGACCA ATCATTATAT TCGGTTGCGG AACGCTGGCC CATCGCTCGC    115980
     CAAGCCTTCA GTGCGTCCGG CTGGACGCTA AACGGGTTCA CGGATAGCCC AAGCACATTT    116040
     TTTGTCGCGA CGATCTCCTC TGGGCCAAGC GGTTCGCCAT GAACCTTGTG GCTGCCTGCT    116100
     TTCTTCGGGG CGCCGAAGCC AATCACGGTT TTGCATGCAA TGAGGCTGGG TTGAGTAGAT    116160
     ACCTTAGCGC GTGCAATTGC GGCATCGATT GCCTGTTCGT CGTGCCCGTC GATGCGCTCG    116220
     GCTCGCCATC CCGCAGCCTC AAAGCGCTTC ACCTGATCAA CCGAGTCTGA AAGAGTCAAC    116280
     GGCCCATCGA TCGAGATGCC ATTGTCATCC CAAAGCATGA TCAACTTGTT CAGCTTCAGA    116340
     TGCCCGGCGA GTGCGATCGC TTCATGGCTG ATGCCTTCCA TCAGATCGCC ATCAGACGCC    116400
     AGCACGAAAG TATAGTGATC GACGATCGCG TCGCTGAATT CCGCTTGAAG CTTTTTTTCG    116460
     GCCAGCGCGA AACCGACCGA GGTCGCGAGC CCTTGGCCAA GCGGGCCAGT CGTGGTTTCA    116520
     ACACCCAGCG TATGTCCAAA TTCCGGATGT CCCGGGGTGT TAGAATCAAG TTGTCTGAAC    116580
     CGCTTCAACT CGTCGAGGGT CATACCCTCA ACCCCGGTGA GGTACAGCAA CGAGTAGATC    116640
     AGCATCGATG CATGACCAGC GGAAAGTATA AAGCGATCGC GGTCTGGCCA CTTGGGTTTT    116700
     GATGCGTTGA ACTTCAGGTG TTTCGCCCAC AGCACAGTGG CTACATCAGC GAGACCTAGC    116760
     GGTGCACCAG GATGTCCGGA TTTCGCTGCT TCTACCCCGT CAATCGCTAA ACCACGCACA    116820
     GCGTTTGCCA TAAGATCGTG AACGGCACTG TTTTTCATAT TGGTTACAGG TCTTTCGGAT    116880
     TGATGTTGCA CCAAAATGTT ATCTAGGATG CGATGATGAT CCGCGTGGCT CAAACGATTT    116940
     TCATGGCGAT AAACGCGCGA AGTTTGTTGA GGTCTTCCGC AAACAGACGG ATACCTTCGG    117000
     CGAGCTTCTC AGTTGCCATG GCGTCTTCAT TATGTTCGAA GCGGAAGGTG GCTTCGGTGA    117060
     GTGCACCCTC CCTCCCAGAT TGCGTGACGG TATTTGCGTC GAGCTTGCGA ACAAGTACGC    117120
     CTGTGGTGTC TTCGGCGAGT TGTTCGAGAA GCCCCGGCGC AATGGTCAGT CGGTCACAGC    117180
     CAGCCAGCGC TTCGATCTGA CCAATATTCC TGAATGAGGC GCCCATGACG ATGGTTTCGT    117240
     AGCCTTGGCT CTTGTAATGC TTGAAGATAC GCGCGACTGA CAGGACTCCA GGATCGGAAT    117300
     CGGGTGTATA ATGCTCGCCA GTCGACTTCA CATACCAGTC GAAGATACGG CCGACGAAAG    117360
     GAGAGATCAG GAATACGCCC GCCTGAGCGC AGGCGACCGC TTGCGCGAAG GAGAAGAGAA    117420
     GCGTCAGGTT ACAATTGATC CGCTCTTTCT CGAGAATCTC AGCCGCCTTG ATACCTTCCC    117480
     AAGTGCTTGC GAGCTTGATA AGCACGCGTT CACGCCCAAT ACCGCGGCTT TCATAATTGG    117540
     CGATCAAGCA CCGCGCCTTA TCCAGCAAAA GAGCTGTGTT GAAAGACAGA TCGGCGTCTA    117600
     CCTCGGTCGA CACGCGACCG GGGACGATCT TCGTCAACTC TGTGCCGAAG TTCAATGCCA    117660
     CACGATCGCA CGTGGCTGCG ATGATTGCGT CGCGGTCGCC AACTTGCCGC CGCCCCCATG    117720
     CCACAGCCTC GTCAACGAGA TGAGCATAGG TGGGGTTCGT CGCAGCTCTC AGAATCAAGG    117780
     ACGGGTTGGT CGTGCCATCG GTCGGCATGA ACTGCCGGAT TGATTCGATG TCGCCAGTGT    117840
     CGGCAACGAT GATCGACATG TCGCGCAATT GTTCAAGCTT GTTTTTTTGC ACATTAGGCA    117900
     TTGGCCTCAC ATGAGCCTCT CTAGAACGGA TGATTACATT TGCGACATCT GGGCGAAATT    117960
     TCTGGTGGTG GCATCGTGCT CGAACGATGC GCGGAGGGCT CAGCGCATGA ACCTCTCCAA    118020
     ACGCTTAGGT TCGCCCGGGG TAAAGATTGC GCCAGCGCTC GTATCTCTCC GCATAGGTCC    118080
     GAGTGAAGGC TGGGGTCGGC ACGATCGTCT CAAGAATTGC TGGCGGCCGA CAGACCGCCG    118140
     TAGGCGATTC GCCTGTCGCG GCAAGTCGGC CGAGCCTGGC GGCCCCGAAT GCCGCGCCAA    118200
     CTTCGCCTTG AGCGACCCGG TGAAGCGGCA AGCCGAGCAC ATCGGCAAGG AGCGCCACCC    118260
     AAAAGTGAGT GCGTGAGCCG CCCCCAATCA CGGTAGCACT CTCCACCCGC GTGCCAGCCT    118320
     GAGAGAGAGC ATCAAGGCAA TCGCGAATGC CATAGGCCAC GCCCTCCAGC ACCGCTTGTG    118380
     TCAGAGCTGG CCTATCCGTT TCGTGCGCTA GTTCAGCGAA AGCACCACGG AGGCTCGCGT    118440
     CATTGTGTGG CGTCCGTTCC CCAGAGAGGT AAGGCTGGAA TAATGCTACC CCTGGACCGC    118500
     TCGGTCGCCG GGGTAATTCA GCGAGCAGGT CCGCTTCAGA ACGGCCGACG ATGCGCGCCC    118560
     ACCAGGACAG GCACGATGCA GCCGACAGCA TCACACCCAT TTGATGCCAA AGCCCAGGGA    118620
     GTGCATGACA AAATGCATGA ACAGCCGAGG AAGGATTAGC AGCAAAGCGA TTGGTCGTTG    118680
     CCCAGACTAT ACCTGAGGTC CCGAGCGAGA CAAAGGCATC ACCAGACCTA ATCGCTCCGA    118740
     GGCCTACAGC GCCCGCAGCA TTATCGCCGG CTCCGCCGGC AACGACTGGC GGCGTCGTCA    118800
     TACCATAGCG TGCCGCGAGC TCCGACCGTA GCCGCCCGCT TGGCTCAGAG CCTTCGATTA    118860
     GGCGGGGCAT CTGTGCCCGG CTGAGGTCGG TCGCAGCCAA ACATTCGTTT GACCAGTCGC    118920
     GGGCCGCCAC GTCGAGCCAC AGAGTGCCGG CCGCGTCCGA CATTTCGTCG ACCTTTTCAC    118980
     CAGTCAGAGC AAGGCGAACA TAAGCTTTCG GCAGGAGGAC AGTAGCGATC CGACGGAAGA    119040
     TGTCCGGTTC GTGCTGACGA ACCCAGAGGA GTTTAGGCGC CGTGAAACCC GACATAGCGA    119100
     GGTTGCCAGT AATGACACTG AGCTCAGGGA CGGCGTGCGT TAGCGTGACG CATTCATCCG    119160
     TAGACCGGCC GTCATTCCAC AGAATGCAGG GGCGCAGGGG CCGATCGTCC GGGCCCAGGA    119220
     GCGTTGCACC ATGCATTTGC CCCGAGAGGC CAATGCCTTC AACCCGCGCC AGGGCGGCCC    119280
     CGTGTGACAT TTTGAGGGCA TCCAAAGTGG TAAGAGTCGC ACTGACCCAG CTATCCGGAT    119340
     CTTGTTCAGA CCAGCCAGGC TGTGGGCGTG ATACCTGCAA TGGTTCCGAC GCAGTCGCGA    119400
     GAATTCGCTC GTCCGCATCG ACAAGTACGG ACTTCACAGC CGAAGTACCG ATATCAATGC    119460
     CGAGAAACAT CTTCGCTCTC CTGATATCGG GCGCGGCCTC CGAAGGATCC CTGTCTGGAC    119520
     AGACCCCGGG GGTCGCTCAG CAGTTGCTGC CCCGCCATTC GCTTGTAAGC GGAGGGCGTC    119580
     ACACCACGCT CCTTGCGGAA ATGACGATTA AAATTGGACA CATTGTTGTA GCCAACGTCA    119640
     AAACAGATGG ACGTGATTGG GACATTGGTC TCAATCAAAA TTCTGCACGC ACGGCCAATG    119700
     CGCAGCTTGT GTACATATTC AACGAAGGTC CGACCCGTGT TCTTCTTGAA AAACCGTGAA    119760
     AAGCCAGAGG CCGTCATACC GGCGATCTTG GCAGCGGCCA CCATGCGCAC CTCACGAGAG    119820
     AGATTGCTGA GAACATAGGA AGTAATGTCT TCCATAATTT TGGCGGTACG CGGATCGAGG    119880
     CTTGGCGCGT AATCCACGCC GGCCAAAACG GTCTTTTCAT TCGAACGGGC AAGCATATCG    119940
     ATGAGCTCGA AGAAGAGTGT CAGGCGGTGG AAACCGTGGG CTTCACCGAT CTTCTGCAGA    120000
     ATTGCAGCAC CTCGCTTCGC CGTCGCCCCG TGGAATTCGA GGCCGCGCAG ACCGAGGTTC    120060
     AGAAATGAGC GAATCTCGAT AAATTCCGGG AACATGGCGG CTGCGTGAAC CAGCAGGCTC    120120
     TCGTCGAATT GCAGGACGAT GTCTCGCCTT TCGATGAACT CGCCAGGCGC GATATTGCTT    120180
     ACCCATACAT GCGGCAGGTT GGCGCCCACG AGGCAAAGAT GGCCAGGAGC GAAATCGCCG    120240
     ATGTAGTCCC CAATAAAAAC TGTGCCGCAC GAGCGCGTGA TGAGATGGAT CTCGAATTCC    120300
     GGATGGTAGT TCCAGCGCGC TAGCGCGTGC GGAAAGCTAT GGGCGTGCCA GCGGAATGAC    120360
     TGATCGGAAT CACAAATGAT ATATTCAAGC TCGGGGCACT TTACGGCGCG ATCAGACATT    120420
     GCTTCGTCCT CGCAGGAGAC GCTCGTGGAC AGTGACCATT CGGTCTTTGG ATCGAAGGCG    120480
     ATGCTGCGAT TGCGCTGTGG CAATCATCTT ATTGTACTCG CAGTGCCGCC GTCCGGCATT    120540
     TCTTCGAGAC TGACGATCAT CCGGAGAATA GTCGACTTTG ACCCAGCTCG GAGAGGATCG    120600
     CGAATGCATT TTCCGCAACA TTAAAGCTGA ATCCAGGGTG AACTTAACCT TCCAGTAGCG    120660
     CTTGATCACA TGGCTGCGCA TGACGATTCC CATATCAAAC GAACTCGCCG TCGATCCGGA    120720
     TCTGAAGCTT GATATCGGTA GCACGGGCTT CCGCCGCGCG ATCGAAGGCT TCGATGCTCC    120780
     TGTTGAAAGG GAAGGTCTCG GAAATCAAGG GTTTCAGATC GACCTTGCCG GACGCGATGA    120840
     GATTCAGGGC ACGATCGAAG ATGTTGGCAT AACGGAATAC CGTCTCCATG CGCACTTCCT    120900
     TGGACTGGGC CTTAACGATA TCGAAGGTGA CCGGTTCGAT CGGGCAGCCG ACAAAGACAA    120960
     CCGCCCCGCC GGGCCGTACG GCATCGAAGA GGTTCGAATA CGCCTTGGCG CTACCGCTCG    121020
     CCTCGCAGAC GATATCGACG CCCCAGCCAG CCGTCGCATC GCTAATTGTG GCGACAAGAT    121080
     CCTGTTGGGT GATATTGATA GGTGTAATCC CAACATATCG GCTTGCAATC TCCAGCTTCT    121140
     GTTGCTGAAG ATCTGCGATA AATACTTGAC TGCAGCCGCC GGCAAGTGCG GCGAGCGCTA    121200
     CCATGATACC AATTGTCCCG GCGCCAATCA CAAGCGCCAC GTCACCGGGG ACGATTTTTG    121260
     CCTTTGTCGC TGCCTGCAAC CCTATGGCCA AGGGCTCAAC CATTGCACTT TCGCCGAAAG    121320
     AAACATTCTC GGGTATTTTG TAGGTGAAGG CCGCAGGATG GATGACTAAA GGGGTGAGGC    121380
     AGCCATGTAC CGGTGGAGTC GCCCAAAATA TAACTTCCGG ATCAATATTA TACAGCCCAA    121440
     GCTTGGAAGC CTTCGAGTGT GGGTTGGGAA TTCCTGGCTC CATGCACACG CGGTCGCCTG    121500
     GCTTGAGGTC CTTCACTGCC GATCCCACTT CGACGATCAC CCCTGAGGCT TCATGGCCGA    121560
     GAATCATGGG CTTATCGACA ACATAGGGTC CGATATGGCC GTGGGTATAA TAGTGCACGT    121620
     CGCTGCCACA TATGCCTACA GTGTTGATGC GGATCTTGAC ATCTTGGGGG CCGATATTGA    121680
     GCGGGAGATC GATGTCGCGC AGTGACAATT GACGCTTTCG CTCTAGCACT AATGCTTGCA    121740
     TCGTTCGATC CTCGGTTCCC TTCAAACTGA AATTCAAAAG CCTATTAGCA CGCCAATGAA    121800
     CAGCACTGGC GCTGCATGAG TTCCTGCAGC CACCATATTT GCTATCTCAA AACGCCTAAC    121860
     TGCTAAGCAA TATTGATTAA TCGTCGGCGA AGTGCGTCCC TAGCGCAGGC TGGACCATCC    121920
     CTTGTAGTCC GCAACGTTGT CCTTGGTGAG CAGGGTCGAT GGCATTAAGA TCATCGGGTT    121980
     ATCCGGCTTC TTGCCGTTCA TGATCTCGTA GCCAATTTGA ACAGCTTGTT GCGCCATGCC    122040
     ATAGGGATCC TGGCTGGCCG ACGCCTGGAT CCGCGTATTG CCGCCTTTGA ATGCCTTCTC    122100
     AATGTCTGGG GCACCGTCGA CCGAAGCAAT GAAGAACTCG TTGCGGCCAA ACTGCTGAGC    122160
     AGCGAGATCA CTTCCAGTAG CCTGTGGGTC ACAGACCGTA AAGACTGCAT CAATTTTCCG    122220
     ATGACGGGTG AGATGACCCT GCATGATTTT CATGCCTTCA TCGCGGGAGC ATTTACCATT    122280
     CTGATCGTCC GACAGGATCG TGATCTTCGG ATTGTTGGCC AGGGATTTTC TACAGCCGGA    122340
     TACACGGTCA ATTATCGACG ATATTTGCGG CCCGTTCTGA ATGATGATCT GACCGCCAGC    122400
     GGCACCCAGC TTGTCAACTA TGTATTGGCA GGCGATCTCG CCGGCCTGGA CATTGTTGGT    122460
     TTGCACCGTC GCATCGGCCC CAACCGCGGC GACGTCGGTC GCCATCACTA CGATTCCTGC    122520
     ATTTTGCGCC CGCTTGATCG CCGGTGCGAT CGCCTTCGGA TCGGCGGCGG CGAGCAGGAT    122580
     TAGATCGACG CCCGAGGCAA TGAAGTTATC GATTTGGTTG AACTGCTTGT TTAGATCGTA    122640
     ATTGGAGTCA ACGGTGATAA CCTTGACATC GGGGTTGATC TCTTTGGCCT TGGCCTCAGC    122700
     ACTCTGCGAC AGGGCTACAA AATACAAATT GCCGAGCGAG CCTACCGAGA CCCCGACAGA    122760
     TTTAAGATCC TTAGCCCCGG CGGCTCCCAT CGCAAGGACG AGGATAGCAC TGCCCATCAA    122820
     TAACTGCTTG ATCATGGCGT TTCTCTCGAA ATTGTTTTTG ATTGTATGGT CCGGATGAGA    122880
     ATAGGGGGCA GCGATTTTCA TGCTAGGGTG GAAATTGCCC AATACCTATA CGAATTTGCG    122940
     ACGGATACCG GCGCGGTAAG GTTGTCCAAC ATGATCCTCG ACAACTATGC CTGTCGGAAG    123000
     GTAGCTAATT GGGAACGGTT TATATCTGTT TGGGGACTGG AAAGAATTTG GGGTAACAGG    123060
     ATTGTTGAGG CATGATCGGC TTTTCCGAGG GGAGGAAAAG CCATGCAATG GCGGATCAAG    123120
     CTGGAGGCAA CGACCGGCTG GGTGAAGTGA TCGAATATGA GGTTAGTCAG GTGGAACGGC    123180
     AGTTCTCAAC GGCAACTGCA GAGGATTTCG GACTCACGCT CAACGAAGGA AAAGGCATCC    123240
     TGCGCCAGCT GCAGGCCGTC ATGGTTGCAA GCCAGATGCT GGAATTCAAT GTCGCCAGCC    123300
     AGGTTTGCAG AGCGTGCTAC CCAAATAAAC TCTTTATTTT TATTAACTTA TAGGATAGTT    123360
     CAAAGCTCGA TTTTCGAGAG TGAAGACTTC ATTCAAGAAG AATGATCGGC GCAATTGGGC    123420
     TCGTGCAAAT TTTGAATACG GACACGGGAA GACGTTTGAG ACTGTGATTT TTACGCTCTG    123480
     TTCACCAAGG GAAGTCCGAA GCAGACAGAG AGCAGGTTGT TCTGCTCGCG GACAGTCCAG    123540
     GGACCGATGA AGCCGAAGCC TTTGCGCAGC ATGGCCTCGA ACCCTTTGAT GGTTCGTCTG    123600
     GCGGTGTGAA AGGATTGGAA GCAGCCGACC TTCGGCATGT TTTGTTTGAC CCTAAAATGG    123660
     TCGCTTTCGA TGCCCTGCTG CAGGTGTTTG GTGACCCGAT GGATCGGGTT CGTGCGCAGC    123720
     AGGCCTTCCT TCTCCGCCGC CTTGATGGCA GGCGGGAAGG TTTTGGCACC ATCGGTGCCG    123780
     ATATGATCGG GTGAAAGCAG AGGCTCGTCC TTCAGCATCT TGCGGAAGAA CCGCTTGGCG    123840
     GCGGCCAAAT CACACTGCGC CGTCAAAAGG AAATCGACTG GGTTGCCGTG CTTGTCGATG    123900
     GCCCGATAAA GATAGCGTCT GACCTTTGAT CTTCACATAG GTCTCATCGA TGCGGATCGA    123960
     GCCGCAATGC GGCTTGCGGA AGGATCGCAG CCGCGTCTCG ATCAGCGGCG CATGGGCCAA    124020
     AACCCAATGA TTCAAGGTGC TATGGTCGAC CTCGAAGCCA CGTTCGAGAA ACATTTCCTC    124080
     CAGATTTCGG TAGCTCAAGG AATAGCGCAG AGACCAGGAC ACCGCCTGGA TAATCAGCCA    124140
     CGCCTCGAAA TGCCGCCCCT TGAAATCGTC CTGTCGGATG GTCGATAACT GGGTTCTGTT    124200
     CCAATTTGCG TGCTTGATTG GCTTGGTGGA GCCGAGCCCC ACATATAGGG CATGCGGAAG    124260
     AAGATCCATT TGGCCTTCGG GCTTGGCATT GCTGTCGAAA AGATCGACCA TCGCGAGGAA    124320
     GGCTGGGTGG TTTCAGCTCT CGCGTCTGGA ACCCGCAGCT GTCCCGGCTG CGGTGTGGTC    124380
     TCAACCAGGC GGCACAGTTG GCACGTCAGA CACCTGCAGG ATCTGCCGAT CCAGGGGATC    124440
     CCTGTGACCA TCGCGCTGCA GCTGGGACGC TGGCGCTGCC GCAACGAGAG CTGCTCGCGC    124500
     AAGACTTTCG TCGAGAAGAT CTCGACCGCC TTTCCGTTTG CCCGACGGAC CGCACGGGTC    124560
     GGTGAGATCA TTCGCCTCTT TGGCCATGCC GCGGGAGGCC GGGTTGGTGC AAGACTGTTG    124620
     GACCGCCTTG CCATGCCAAC CAGCCATAAC ACGGTCCTGA GGCATCTCAA ACGGCATGCT    124680
     TCGGCGAGCA AGCTCAAGGC TCCCCTTCGG ATTGCCGCTA TCGATGACTG GAGCTGGCGG    124740
     CGGGGCGAAA CCTACGGCAC GATCATCGTC GATCTCGAAA GGCGGACCGT TGTCGATGTC    124800
     TTGCCCGTTC GTTCCGTCGA GAGCACGGAG CACTGGCTCA GGCAGCATCC TGGCATCGAG    124860
     ATCGTCAGTC GGGATCGGTG TGGCCTCTAT GCCCAGGCCA TTCGGCAGGG CGCGCCCCAG    124920
     GCCCAGCAGG TGACCGACCG GTTTCATCTG CTGCAGAACC TGCGGGAGGC CATCGAGCGC    124980
     CAGATGGAAC GGGTCAGCCG GTTTGCCGGT CGCTCTCTTC TGCCAGCGGG TTCTGACGCC    125040
     AAACGGGAAG CACCCCGGCA GGCAAGCCGG GAAGCCCGAT TGGCGTTATT TCAAAATGTT    125100
     CACGAGCTAC ACTCGGCCGG AATGCCTATC ACGGCGATCA AGGACAAGAC CGGGCTTGCC    125160
     CTGCACACGC TGCGCCAATG GGTCCGTCTG GATGACTTGC CGGCGCGCCG TCACCCCGCT    125220
     CCGACCGCCA GATCACCGGC TTCTTTCAAG GATTTCCTGA AGCAGCAATG GGAGGCTGGA    125280
     AACCGATGTG GACGCCATCT TCTGCATGAT CTCCGCCATC GCGGCTATAC GGGCAGCCGC    125340
     TCTCACCTCT ATCACTTCAT CGCGGAATGG CGGCGGCTTG AGCCGGATGA GAGCAGGAAC    125400
     ATCAAGGCGT CACCAACACC ACATACGCCA CTGGCGGAAA CGAAAGCAAT TGACCCAGTG    125460
     ACGGGCTGGC AGATCTCGCC GAAAGTCGCC GCAGTGCTGT GCCTGAAGCC GACGCGCTTG    125520
     CTGACACCCC GTCAAGCACT CAAGGTCAAA GCCCTGAAAC AGGCCTCTCC AAGCTTCGTC    125580
     ACCATGCGGG CTCTAGCGAT GCGGTTTCGT GGTCTTATGC GCAGCAAGGA GCCATCAAAG    125640
     CTCGAAAAAT GGCTCGAGAA GGTAAGACAT GCCGCCATTC TCCCTCTGCA GCAATTTGCC    125700
     AAAACGCTGA GGCGTGATCT CGCCGCTGTC CGAAACGCTA TTACTCAGCC TTGGAGCAGT    125760
     GGGCAAGCGG AAGGACAGAT CAACCGCTTG AAAACACTCA AGCGGACGAT GTACGGAAGA    125820
     GCTGGCAATG AGCTGCTCCG CGCTCGGATG ATGCCGTTTG ATTTCGTAAA TGAAACTGTG    125880
     AATGGAATGC CTGATCCTTG AGGCCGACTC ATTAGAAAAG AAACGACAAA ACAAAGTGTT    125940
     CAGCGACAGC ACTTTGCTGG GATAGCGATC TGAACCACTC ACGCTGCACC GCACACAAAG    126000
     CTTGAACGTG TGCTTACATT TTTTCCTGCC GCAAATCAGA ATCCATCCTC TTGATATCGG    126060
     CAGAAGAATT GATGCCAGGC AGCACGCAAA GTGGAACAGA ACCCATTTAA TGACAATCCG    126120
     ACAATGCCGC CTTTGGTCTT TTCCTCTGCA TCGATACGAC GGACCAGAAC GCGGTCGTAC    126180
     ATGGGACGAA ACGTCGTCGG TTTCTCCTGA CAAAATTTCA AATTTTCGAA AAAGCGAGGC    126240
     TTGACCGCCT CGATCGGCGA GCTGGGAGCG CCCTCAAAAG AGTTCAAGAG CTTATTTAAA    126300
     AAATAGCATT CTCGTGAGAG ACTGCTAATG CTTGTTTTTA AGAAGATAGG CACGAAAAGG    126360
     TGCAAGGTTG GCCTATCGCC AACCTTTGGT CTCTGCCGAC CTATTCTCTG ATTTTCAGTT    126420
     AGGGATTAGC CGCCAGCACG GAAGGCTGCT GCTCTGCACG AGGCTGGTTG ACCGGCAGGC    126480
     TTTCACCATC ATATGGTTTG GCCTTCACGG GGATTCCTCG GCAGCTCGCG ATCAGGCGAT    126540
     AGGTCCAGAC GTCATCGCCT TGTACTTCTT GGACGATGAG TTCAGTCCCT TGGGTCCAAT    126600
     CTGCTGTCTT ATGGATTTGG TCAGGTGCGA TCTGGAATGC CGACCTATCG ACCAACTTAA    126660
     CAACACCGTT TCTGTAGGTT GAGAGAAGAC TTATTCGAGC CATTTCGAAG CTCCATTGTT    126720
     GCTCGCGTGA CGCCCTTTCT CGTGTCGACG CCAGAAAAAA TATTTTACAC TTTCAGGCAA    126780
     AGCAAGACCC TTGAAACCCA CTTCTCGCTC AAACAAAAAA TTCGGCAAAA AATTTTCGGT    126840
     CGCCTCTTGA TGAGGCGGAA TACGCCGACC AAATCGATGC CCGTCAAGGC TGGAGGCCTG    126900
     ACAGAAAGGG CGCTGCTCCG GCAGCCTTAA TCATATTGCT CAATGGAGGA TGTGGTCATG    126960
     AGAACCTTTG ACGTTGCTCC CCTTTATCGT TCAACCATCG GCTATGATCG CTTGTTCGAC    127020
     ATGCTGGATC ATAGCACCCG TCCCGATTGG CCGCCCTATA ACATCGTGAA GAAGGGCGAT    127080
     AACGAATATT GCATCAGTAT GGCCGTCGCC GGATTTTCGC CGAGTGACAT CAGCCTGACT    127140
     CAGACGGGCA CCCAGCTTCT AGTCGAAGGC ACCAAGCGGA AGCAACCGGA GGCGTATGAA    127200
     GTCCTCCATC AAGGGATTGC TTCCCGCGAC TTCAAGCAAA CCTTCAATCT CGCCGATCAC    127260
     GTGAAAGTCG TCTCGGCTGA TATCGAGAAC GGTCTCCTGA TGATCGATTT TGTCCGTGAG    127320
     GTTCCGGAGG CCTTGAAACC TCGGAAGATC GAAATCTCCC AAACTCGCAT GGAAGGCGGT    127380
     GCAGAGCCAA AACAGCTGAA ACAGAGCGAT GAACCTGTAG CGAAGGCGGC TTAAACTCTT    127440
     TGTTCACTAC TGATGCTTCC CGAATCTTCT CCGGGAGGCA GAATTGGTGG AGATCGGAGA    127500
     TGGATACAGA GGCAGTTTTT CATTCTTCAA CAAATGTTAC GACCCTGTCG CGCTGCTTTT    127560
     ACGATCCTGA TGAGGTAGCA CGCGACTCCA GCCTGAGCCT CAACGAGAAA CGGGAGATTC    127620
     TGGCAAGTTG GGCATCGGAT GCAAGGTCGA TAAAAAACCA CCCGGCCTAT AGGCTCATCG    127680
     AGAGCGGGCA GATTGTTCCG CTCGATGAAA TATTGAAGGC GATCATTCGG CTTGACGGTG    127740
     AAAGTCGAGT GCAAACCGGT CATCTATGGC GCGATCAAAA GAAGGACGAC GAAAGCAAGT    127800
     CGGATGAAAT TGACGACGAT GACCCGGACG ATGATCCCCC TCCTGTTCCA GCAGGCGGAT    127860
     TCATCCCCTG GCGTCCCAGG CCGCCTTTAA CTCCGGAAGT TGCTCTTTGA TTCCGTGCCC    127920
     CTGGAGCCGG TTTTTTGACT GGGTCCAGGG TAGTTGGAAG GGTCGTCGTC GACGTCGTCG    127980
     ACGACGAATG GGCATCAAAA CCGGAGATAA GGGCAACCCT TTTATACGGG CGCGTTGCAA    128040
     ATTATGAATA CGGATACAGA TCGGCGTGTG CAAGCCTGAT CTTCATACTT TGTTAACTTC    128100
     TAAAAGTCCG AAACAGACGG AGAGCAGATC GTTCTGCTCG CGGACAGACC AGAGACCGAT    128160
     GAAGCCGAAA CCCTTGCGCA GCCAAAGCGT GGCTTCGAAG CCTTTGATCG TTCGTCTGGC    128220
     GGTGGCGAAG GATTGGAAAC CACCAACCTT GGGCATGGCT TGCTGCAGGT GTTTGGTGAC    128280
     ATGATGGGTC GTGTTTTGGC GCAGCAGGCC TTCCTTCTCG GCCGCCTTGA TGGCGGAAGG    128340
     GAAGGTCCTG GCGCCATCGG TGCCAATGCT GCCAGGCGAA AGCAGCGGCT CATCCTTCAG    128400
     CATCTTGCGG AAAAAACCGC TTGGCGGCGG CAAGATCACG CTGGGCTGTG AGAAGAAAAT    128460
     CCACAGGATT GCCGTACTTG TCGATGGCCC GGTACAGATA CCGCTACTGG CCACGGATCT    128520
     TGACATAAGT CTCGTCGATC CTGATCGAGC CGCAGTGAGG CTTGCGGAAA AAACCGCAGC    128580
     CGCTTCTCGA TCGGGGCATA GGCCAAAACC CAGCGGTTCA GGGTGGTGTG ATCCACTGCA    128640
     AAGCCACGTT CGAAGAACAT CTCCTCCAGA TTTCGATAGC TCAAGGGATA GCGTAAATAC    128700
     CAGGAAACGG CCTGCAGGAT CAGCCAGGCC TCGAAATGCC GAACCTTGAA ATTATCCCTG    128760
     GACGTGCGCT TCAGCTTCTC GGCAATGGCG TAGGAATCAT GGCTGGCCTC CTAATCGAAG    128820
     GCGTAAAATC CGTCTATTTC CTCAACACGC CGTTAACCAT AAGATTTTGC AACAGGTCCC    128880
     TGAAATCGGG GTTCACCCTT CTGACCGCCG ACGTCAGCGA TTTTGATTAT CTGCTTCAAT    128940
     TGATGCCGAC AAGGCGCTTA TTGTTTTATC GCCGATCCTC ATAATCACGC GGCATGGAAT    129000
     TGTCAGTCTT GCTGGCGGAC CACGTCGTAA AATTTGCGCA CTAGTATAGG TTATCGATAA    129060
     GCAGTCCTGA TTGAATACCT TCAGGTTAAC CGGCTCACCC GCGTGAATTA TGGACAGCGC    129120
     CGTCACGAGG GAGTGCCGGC TTCACTGCCT TCGTGGAAAG TACGGTCAAC GAGATCTGTC    129180
     GAAGCGCATG ATCAAGAAGC AGCCTTTCAT CGATGTGCGC GTTTCTGTGC GCGATAACAC    129240
     GCTCCGTAGG TCGTTCAAAC ATGTCTATCC CGCATTTCAG GCAAAGAATG ATAATCACCG    129300
     GGCGTTAATT GCAGCCTGAT GACCCCACGA TTTTACATGC TCTTTTTGTC GTATCGCGTT    129360
     GTCACTCGTC TGAACTGTTT GAGCGGAGAG TTGTTGAAAA AACGCTCAAC AAGATTACGC    129420
     TTTCTTATAA AGCTTAAGGA CCCTGAACCT TGCGATTAGG CTTTGGCAGA ATGACGATTT    129480
     CGCTGCTTTG TTTGGTGATC TTATCGTGGA GATGATTAAC ATTATAACCT TTGTCGGAAG    129540
     CGGTTGCGTC CGCTTCAAAC ACCTCGATGA GTTCGCATAC ATAGACAATA TCATTTTCCT    129600
     GGACCGGGGT CGCCGATCTG CGGACTGGAT TGCCGAGCGC ATTATTGTTC GCATGGATTT    129660
     TGGTCCTCAA AGACCGTTGG GAGCGACTAA GACCTTGGCA TTCAACCCCT TTTTACCTGA    129720
     CGGGCGCCGG CCGCGTGTTT ATGCATACGC ACGATGGTCG AGTCGATCAT CAGCCATTCC    129780
     AGGTCGACTT CACGCGCCAG TGCCTCGAAT ATGGTATCGA GAACGTCCAT CTCGATCCAA    129840
     CGACAAGAAC GCCGCTTGAC GGCGTGATAT TCACCAAGCC ATTCGGAATG GTCGCGTCCC    129900
     CGAACGCCTC ATCCACAAAA GCGCGTTCAC AAAACGCTTG TTGTCCCTGT GTGGTCCACG    129960
     CTTGCCCTTG CCGCCGCTGG GAACCAAAGG CTTAAGGCGC TCCCACTGAT AAAACTTAAA    130020
     TTGTCACTAC CGCCTAAATC GGCAACCTTT TCAAGAATAC GGAGTTGCAA TCAAACCCGA    130080
     TTTCCATGCG ATGGAAAAAT CATCATGAAA CAGGAAAAGG AAGAAAAGGA AAGCGCCGAT    130140
     CCCAAAGGTC AAACCGGAGC CAAAAGCTCA TCGGACGTTA CCGGAGAAGA CGCCAAAAAA    130200
     CAGGACGCTA TATCGATGTT GAAGGCGGAC CATCGGGAGA TAGAGCAATT GTTCGACCGA    130260
     TACAAAGCTG TCTCTCGTCG GGCTGACCGC GCGAAGATCG CGAAGGAAGT CTGCAATGCG    130320
     CTGACGATCC ATGCGATACT GGAGGAGGAA ATTTTTTATC CTGCTTGCCG TGAGCTTATC    130380
     GACGACCAAC CGCTCGACGA AGCACAAGTC GAACACGACA GTGCGAAGGT GCTCATCGAA    130440
     GAGCTGATCT CCGGAAGACC CGAAGACCCT TTTTACGATG CAAAGGTCAA TGTATTAGCC    130500
     GAACAGGTTA AGCAGCACAT TCGAGAAGAA GAAGGGAAGC CCGACAGCAT TTTCGCAAAG    130560
     GCCGAGGCTG CCGGAGCCGA CTTCGTCGTC ATTGGCGAAG AGCTTAAGAA GCGCAAAGCG    130620
     GAACTTTTGA GCAAGGCTAG CCGAGAGACG CTGCAAGCGG AACCGTGCTC ATTCAAAGCC    130680
     CTTGCAAATC TCACCAAGGA AGAAGACATG GCATCTTATC AACGCGGCCG AGACTATGAG    130740
     GAGCGCGGCC CGTCGCGCTC GCGTTATGAT GAAGAGACAG GTCGGCGGCG GGACGAGCAG    130800
     GGCCGCTTCA TGAGCAACGA GGATTATGGC AATCGTGGTG GACAAGAACG CAGGTATCGC    130860
     GTCGGGTCCG AGCGCGATGA ATACAGCCGT TCCTCGAGCG ATCGCGACCA AGGTTATCGT    130920
     TCGCGTCCAT CCTATGAAGA CGAGGAATAT TCCTCACGCG GCCAGCGTAT GCCCGAGCGC    130980
     GACGAATATG GTCGATTTGT GAGCGATGAT GAGCGTCACG GCCAGAGTTA TTCCCACGGA    131040
     CGCGATTACG AGAATGAACG TCGCGGGTCT CGCAGCCATG GTGGCTGGTT TGGGGATCCC    131100
     GAAGGCCATG CGGAAGCCGC CCGCAGAGGT TGGGACGAGC GCGAGGGCGA AGGCCGCGCT    131160
     TATCGCGATG AGAACGAACG CAGAAGCTCG TCGCAGGGAA GCGGACGGCG ATACGAGCAG    131220
     CGTTCACGGC AGGAGGAGGA TGACGAGCGA CGCCAGGGCA GCGGACGCGA TTACGAGGAT    131280
     GAACGTCGCG GCTCTCGTAG CCACGGTGGC TGGTTTGGGG ATCCCGAAGG CCATGCGGAA    131340
     GCCGCCCGCA GAGGTTGGGA CGAGCGCGAG GGCGAAGGCC GCGCTTATCG CGATGAGAAT    131400
     GAACGCAGAA GCTCGTCGCA GGGAGGCGGA CGGCGATACG AGCAGCGTTC ACGGCAGGAG    131460
     GAGGATGACG AGCGGCACCA GGGCAGCGGC TGGTACGGAG ATCGGGAAGG TCATTCAGAG    131520
     GCGTCCCGTC GAGGCTGGGA ACATCGGCGA TAATCAGGTC GAAGCAGAAG CAGGCCGCGA    131580
     TCGATGCCCT CATTAAGGAC CCGCGCGCGG GTTGGTCGGA CTTGAGGACA AGACCGTGCT    131640
     CGATGCGGCC TCATTGCTTC GAGGCAGCAG GCCAGCGCAG ATCCGGACCT CGTTTGGTAC    131700
     GGTGCAGTCG TGATGGCTCA TACTCTGCCG CTGCGTCAAT TCCGGTGAAA CGCCAGAGCT    131760
     TCGCTCTCGA GCGATGCGGC GATCAAATCT TGCAAAACAC CCTCGTTTAT CTCTTCAGTC    131820
     CAGACCCTAA AACGGGTCAG ACTATGCGGT CCGAACGATG TGACCATCGC CACATCTATG    131880
     GCGTCCCGTC CGCGCGCAAC GGGGATCCGG CCGATGCGCG GAGTATTGTG TCTTGCATCA    131940
     AAAGTAAACC AGCCGCCATC AAGATAAACT TCAAACCAGG CATTATAGTC CATTGGCGTG    132000
     GGATTCGATG GCACACCAAT ATCGCCAAGA AAACCATTGG TATAACGAGC GGGGATGTTC    132060
     ATGCAGCGGC AAAAGGTAAC GGCTAGATGG GCAAAATCGC GGCAAACGCC TTTGCGTTCT    132120
     TCGAAGGCTT CATAGGCGGT GCGCGTCGCG CGGGCATATT CATAGCCGAA GGTCAGATGA    132180
     TCGCAGACGA AGTCGCAGAT GGCTTGAACA CGGTGCCAAC CGCGCGGTGT TGAACCAAAA    132240
     AGCTGCCAAG CGATATCACC AAGCTTATCT GTTTCACAGT AGCGACTCCC AAGAAGATAG    132300
     ACAAGATAAT TGCTTGGTAT TTGTTCCATG ACAACTTCCT GCGCGTCTAA CACCACGGGA    132360
     TCTGGCAAGC CGCTATCATC GATGACTGCA TCACAGCAAA TCGCTAAGTC GCCAGCAGGC    132420
     GCTATGAGTC TGCGTACGTG ATTGCCGTAC AAATCGATAT AGGTCGATGA GTCGATCTGC    132480
     GGTGTCGTGA TGACCGGGGT CTCGTAGCGG ATATGATGCG CGCGCTCTCG ATGCGCGTCG    132540
     AGCATGCACA GCATAAAGGT CGGTTGTTGA CAATTGAGCG TCAATTCATA GCCGTATCTG    132600
     ATGAGCATCA TTGGATCCAA TAATTGTTTA GGTAAGGATC GCAAAAAATG ACAACCTCAT    132660
     TCTCCTTGCG TTTTAGCAAT TCTAGGACAT GGCTTTTCTC TTTGCAGATA GCCAATTGTA    132720
     CGCTCGCCAA AAGTCATGAA TTTTGTGGTA AATAATTCTC CAGCCAGCTT TTGGTTCACG    132780
     CCAACCCCTC AGTTGTTCAG GGTGGTGGTA ATAAAGCCTC ATATAGCGGC CTATTTGCAT    132840
     GGTGGAGCAT GAAAGAAGGA GACGACGCAC GGTGAGGTCG AATCCTTGAA GGAAATTAAT    132900
     CCACAACTTA TTCAAGAGAT CGAAGAATTC TTCATCCAAT ATGAAAAGCT GAGCGGAAAG    132960
     GATTTCCGTA TCGTCGGCCG TTGCGGGCCA AAGTCTGCCC ATAAGCTGCT GGAGGCCGGA    133020
     GCGCAGCGCT GGGCTAAAAA TCCAACTGCG ACGTGTTCGC AAACACTCCT TTCAGCTGAG    133080
     AAAGATGGTT AAGATTGTTC GAGCTTTGGA TCAACCATGG CAATGAACCG AAATGAACTC    133140
     CGCTTTGGTC GTCTCTCTTG CTCATCACGC CATATCTGCG TCGATATACA GAAACTATTT    133200
     GCTGAGGAGA CGGATTGGAG GACACCTTGG ATGGATCGCG TCCTTCCTTC TGTGTACCAG    133260
     CTGGTCGCTC ATCATCCCAG CCAGACAATC TTTACTCGTT TCATCCCAGC CGAACACGCA    133320
     GGCCAAGGGA TTGGGACATG GCGGCGGTAT TATGAACGTT GGTCGTCTAT GACAATCGAA    133380
     TCACTCGGCA TAGCGATGAT CGATCTTGTT GCCGAACTCG CGGCTTTAGT GCCGCCCGCA    133440
     GAGGTCCTTG ACAAGCACGT CTATTCGCCT TGGTTCGAGT CGGACTTGCA TGCGCGACTA    133500
     CAACACCAAT CTGTCGATAC CTTGATCATC TCAGGCGGCG AAACCGACGT CTGCGTTTTG    133560
     AGTACCGTCC TGGGGGCGGT CGACAGAGGC TATCGTGTGG TACTCGCCTC CGATGCACTC    133620
     TGCAGTTCTT CGGATGAGGC GCATGATGCG GCGATCAGGG TCTACGAGAC TCGTTACAGC    133680
     CAACAAGTCG AAGTGGTAAC GACCAATCTC ATCCTTGAGA ATTGGAAGTG AGTCGCCCGT    133740
     GGCGTTGTCC AGCGTGCCAA AGCGGCCATC CCTAATAATG AAAGAGCATC AGCAGAATGA    133800
     TGATCGGGAT TGGAACTCCC AGCATCCATA ATAATATTCC GCGTCCCATT TCATCACCTC    133860
     TTGTTTAACG CCAACGGGTA AAGATACTCA CGCCCGCATA GTTCTTGCGA TGTTGACCGC    133920
     CAATAGTCGC CGCCCACCAA GCAGCAGCAG CACCAATCGC TGAAGCGGCT GCCGATAGAA    133980
     AGGCGGCTAA AATTCCCACC TTCCGCTTCG CATTCGCTGT ATCTCGAACA TCCGTGATTG    134040
     CATAATCGAC GCGCTTTTGG GCATCCACAG GAGTGAGGCC CCGATCCGTT ACTAAGCGGA    134100
     CGAGATAGTC TCGGTCCGAT GCGGTGACAG CGCCATTGTA AACACCGGAT TGAAGAATAG    134160
     CCGCAACTTC GCGACGAAGA CCTTCATTGT AGGGGGTCTC AAGGCGTTCG CCTCGTAACA    134220
     AAGCATCAGC CATATAGAGT GAATGGTCGG TTTGCTCAGG TGTTTTTGAT TGCGCTTCAC    134280
     GCACAATATC ACTCAATGCC GTTGAAACTA TCACGCCGAC GAGCAAGGTT GTCAGTGCCC    134340
     AAGCTATGAG GCCGTGCGCA CCATCACGTA TTTCGCTTTC GTAGGTGCTA ACGTCCGGTG    134400
     TCACATGACG CATCCGGCCT GCGATGTATC CGGCAGCAAT ATAGCTGGAG ACGACGACCC    134460
     AGAGTGTCCA GATCGTAATG GCTATCACCG TGGCTTTTGC TGATAGACCT TGCCCTAAAT    134520
     AGGGAGAGGT AATCGCTAGG CCAATTGCTG ATCCAAACGG TGTCAAAGTC ACGAAGATTG    134580
     CGGTTCCAAC AAGAGCACCA GCAATGATCG CCGGCCATCC AAGGTAGCTG GAGGCCAAGA    134640
     CTTCCGTCAT GGGAACAGCG GCAACAGGTC TTAAATTCGT GTTGTCCATT CGTTCCTCTT    134700
     TCGGTTTGTC CTATAATCTA AGGATCGCCT CATTATATAT TACCGAAGTC CAAGTACCGA    134760
     TAATATAAAC ATGATGACGA CAATCAATCC TACAATATAG ATAATTCCAT TCATGCTGAA    134820
     TTCCATTCAA ATAGATTGAA ACGGTGGCAA CAATTGACGC ATATATTCGC TTCGTTCATT    134880
     GAACGCTTTC TCACTGCTTA TTTTTAGATG AAACTGATCA GCTCAAGTTA AAAGAGCTGG    134940
     TCTGTTTGAA GAGAGAAGAG AATTGTCTGC AGCTTCACGT TATTGATAAC CTTCAACAGC    135000
     GCACAGTGCT TAACCAACCA TCATCATCAC TGATGTGTTC CATCTTCACT TCAGATAATC    135060
     TGTTGTAGCT GAAGCGAAAG TGTCTAGGGT CAGCAAATAC AGAAAGCGTC TGACATACAA    135120
     GCTGTACTGC AATGTTGTCA CACAGCACAG TGCCAAGCAT GCTTGAGGGG ATCACACCTT    135180
     GGAGCCTGAT GATTCCTCAA GACAGGCATT GTCCATTATA AAACGCAGGT ACATGTCAGT    135240
     CGTCACTCGC ACTCGAGGTC CAGGGGAGAT CGGTTAGACA GAAGGAACAA GAGCTTGTTC    135300
     CGCTCGTTTA ACGATGACTG ATAAGATAGC TTTGCTGGAT GATAAACGGG AGGATATGGC    135360
     AATGGTCCAA TCTGGAGGAA ATTTGCAGGA TCTCTTTCAT AGGGAATTGA AAGATATTTA    135420
     TTTTGCGGAA AAGCAGATTT TACGCGCTCT GCCAAAGATG GCGCGCAACG CACGATCGAG    135480
     TGAGCTTCAG CATGCTTTTG AAACTCACGC CGATGAAACG GAACAGCAAA TAGAACGCCT    135540
     TGATCGTGTC TTTGAAAGCA TCGGTCAATT GCCGCGCGGC AAAATCTGTG ACGCCATCAT    135600
     CGGCCTCCTT GATGAAGGCA AAGAGATCAT GGAAGAGTTT GCAGACACCG AAGCACTCGA    135660
     TCCAGGTCTT CTCGCTGCGG CACAAAGTGT CGAGCATTAT GAGATCAGTC GCTATGGAAC    135720
     ATTAAAGGCA TGGGCAGATC AGTTAGGTCC TGTTGACAAA AGTAGGCAGC CAGATTTTTG    135780
     CGGCGGCGAT GGCGAGAAAT TTGAGGAATG AGACTGCGGT TTTGTCGTAG CGCGTGGCTA    135840
     TACGGCGGAA TTGCTTCAAG CGGTTGAACA TGCGCTCGAT CCGGTTGCGA TCTTTATACA    135900
     GTTTGAAGTC GTAACTAACG GACTCCTTGC GATTGGCCTT GGGCGGGATC ACTGGCAATA    135960
     TTCCCTTCAA GAGCAGCGAT GCGCGAACCT CGTCGCTGTC ATAGCCTTTG TCGGCAAGCA    136020
     TGGCTTTCGG CTTGGCGACG GGCATGCCCA ACAGAGCCGG CGTAGCTGCG TAATCCGAGG    136080
     TTTCGCCGCT GGTCAGCACG AAGCCAAGAG GGCGGCCATG ACTGTCTGCG CGGGCGTGGA    136140
     TTTTCGACGT AAAGCCGCCG CGGCTTCGAC CAAAGCCCTC CTTATGCGTC CCCCTTTTGC    136200
     GCCGGCGGCC TGCGAATGGC CCCGAACAAT GGTGGAGTCG ATCATATGCT GCCAATCATC    136260
     CGCCAGGCCG AGTTCGACAA GCGTTTCGAG CAGCGCATCC CAGACGCCTT GCTCGGCCCA    136320
     ACGGCGAAAT CGCACATAGA CCGAGTTCCA TTTACCGTAT CGCTCGTGCA TGTCCCGCCA    136380
     AGGGCAACCA GCGCGCAAAA CGAAAAGCAT CCCATTGAGA AAGCGCCGAT TATCCTGCGC    136440
     CGGCCGCGCC CATCGTCCAC GCTCGGGCGG TAGTAAAGCC TCGATGATCG CCCATTCCGC    136500
     GTCGCTCAGA TCGCCCCGAT TCAAGTGTGC CTCCTTCCAA AAGGCATCTT TGAATCAGTG    136560
     TTCTAACGAT TTGGGAATCC CTTTTGTCAA CAGGGCCTAG GGCTCACCGA AGCAGCCCAG    136620
     CTCCTTGACG CGACACTCGT TGAGGAAAAG AGAATGGATG AGATCCTCAC CAAAATTGCG    136680
     ATGGTTAGTC TCAATGAGCA GGCAGCTTGA TATTTACTGA AGAGATGACC GCGAAGTGAT    136740
     GAGCCTATCC ATTACTGACA GGCTCATCTG AGCTGACTCC ATTCGACGCA ATCATAATAT    136800
     TAAGAAACGG CACCGAGGAA TGGGTTTAGT GTTGCTCTTC GAGATGCATT GCCTCACGCC    136860
     TCAGATATTG CGTCGTGATT TCAGGTAAGT GTGCTCTCAA CCACTGAGCC ATATTTTCTT    136920
     CTTGCGCGAG AATAGCTTCG CAAGCCGAAC GGGTTTCATG ATCCCCAAGT GCCTCAGCGG    136980
     CAGCGATGAG AACCGTATAG GAAGCGATTT CCACTTCCTC GAAACTGTAA CTCGCCATAG    137040
     ACCCTTTGAT AACCTCGTCT CCAGCAAAAA CTCCGCCAAA ACCTTGAGTC ATGGCTACAA    137100
     ATTTAGCAGC AAGATCTTTG ATCGTCGATG TATCTCCTCC GCGCCGTACG ATGCAACGAC    137160
     GAATAATCTG AACTTGCTGG CGTGTCTCTT CAAGGTGACG TTCAATGCGG GATTTGAGAT    137220
     CAGGATAATT TTCAACGCGA CCCGCAAATG AGCTAAGCAT TGTTTCAGCT TGTTGCTCCA    137280
     TAGCGTGGGC ATCGCGCAAC CATTCCACTA AGTGTTCTTC GGCGGTAGCC ATCGGAATCT    137340
     CCATCGGGGT GCTTATGGAA TGATCGCAAA CGTGTTATTC ACCCGATCGT TCCGTCTCCG    137400
     CGGTAAGGTA TCAGATTGAT CTTCCGTGCT TATTTTCCAC AAGCATAGGA AAATGAATGG    137460
     TGAGGTCTAT GTTGCAGCGC AGCTGTAACG GCGATCGTTC CAACATTTGA AACAGCCTAT    137520
     ACAATAACTA AGTATAATAT AGCTTAAATA TTCTTGGCGC TATTTGATAG TTAGAGCGGA    137580
     TTTCGAACGA ATTGAATCAC GTTGAGGATT CCCTTGAGAC ACGATTTCTG ATTCAGAATC    137640
     CGTGCTGGTG AAGGAGGCCG GCATGGATGG GCCACGCACT ATCGATGGAT TTGCGATCGC    137700
     GCTTGTTGGC GGCGATTGAT GGCGGGATGA GCTGCCGTGC GGCGGCGACG CGTTTTGGGG    137760
     TAGCACCCTC GACGGCGATC CGCTGGCAGG CGCAGCGACG CGAGACCGGC GACTATTCGC    137820
     CCAAACCCCA GGGCGGGGAC ATGCGGTCGC ACCGGATCGA GGCGCGTCGG GCGGATATTC    137880
     TAGCCGTCTG GGAAACGCGC AAGGACATCT CACTCGAAGA ATTGCGCCTG GTGCTGATCG    137940
     AGATCGGGCT GACCGTCTCC GTGGCGGCTC TTCACCGCTT CTTCGTACGA CACGGCATGA    138000
     CGCGCAAAAA AAGACTGGCC ATGCAATCGA GCAAGATCGT CCCGACATCC TGAAGCAGCG    138060
     GCGCCACTGG TTTGATGGCC AGCTCGATCT GGAGTCGGAA CGCCTCGTGT TCATCGATGA    138120
     AACATGGACC GCCACCAACA TGACACGTAG CCACGGGCGC TGCGCGAAGG GCGAGCGTCT    138180
     GCGCATGGGC TTCCCCCATG GCCATCGCAA GACCACCACG CTGGTAGCCG GGCTGCGCAC    138240
     CAGCGGCATG GTGGCGCCGA TGGTCCTCGA TGGGCCCATC AACGGCGACT GGTTCGAGGC    138300
     CTATGTCACG CAGATCCTCG TGCCGGAATT GCGCCGTGGC GACATCGTCA TCATGGACAA    138360
     TCTATCGAGC CATAAGCGCG TCTCGGTGCG CGAGAGGATC GAGGCGGCAG GGGTTGCCTT    138420
     GCTGTTCCTC CCGCCCTACA GCCCCGACTT CAACCCCATC GAGAAGGCCT TCGCCCGGCT    138480
     CAAAGCCATG CTCAGAAAAA TCGGCGAGCG CACCGTGAGC GGCCTCTGGA AGCTGATCGG    138540
     AAAACTCGTC GACATCTTCC GGCCAGACGA ATGCGCCAAC TACTTCAGAT CGTGCGGATA    138600
     TGATCCATAG TGATCGGTAA ACGCTCTAAA AAATATATTG ATAGTATCGC TTGTGTTTTG    138660
     TTTTATAATT AAGTGACCGC ATCAAGCAGC CTTGATGGGG TGTGAGGAAT ACAAGAAGGC    138720
     AGGCTCTCGG AGAGATGGAA TCGAAAGCAA AAACAGGAAG GTCAAAACCG CAAAGCACTA    138780
     AACAGGCGAC ACCTAAAGCA GATCGGGCTA TTCGCGTGCA ATACGGCGTT CTGCCCTATC    138840
     GATTCACGGA CATCGGGTCA CTGGAAATGC TGCTCGTCAC GACGCGGGAA ACGAAACGCT    138900
     GGATCATTCC CAAAGGATGG CCCATCAAAG GGCTCAAACC ACCAAAGTCG GCTGCGCGTG    138960
     AAGCCTATGA GGAAGCGGGC ATTCGCGGTA CCGTCGGAAA AAATCAATCG GAGTTTTTCT    139020
     GTACGAGAAG GTGCTCGAGG AGAAGGCTGG CACGGTGCCC TGCGAAGTAC GGGTATTCCC    139080
     CATGCTCGTT AAGCGGCAGC TTGCAATTTG GCCAGAGGCT CATGAACGAG AGACACGATG    139140
     GGTTGTACCG TCCAAAGCCT TATCGATGGT GAAAAATATA GATCTCCAAA AGCTGATCGA    139200
     TTCATTCGTA CAAAAAAAAT CCAAAAATCA TCCCCTTTAG TTTAGCGAAT AAGTGCTGGT    139260
     TTCAGAGCAT CAAATCGGAC TCAACTTGCA CAATACCTCG TCCGCGCTTC TGCATGTGCT    139320
     TCAACGCTGC CATAGACTTG GCCAAGATAG GTCACTTCCG TAACGTGGCG GAATTCGTCA    139380
     AGGCGGATCT CATATACTGC TGCAAAGCTG GTTGCCATGG CATTATTGAT CCATATCTAT    139440
     CGGGCCGAGC TCGTTTTCGA CGCTGTCCGC TGCGGTTTCG ACCGCATCAG CATTGACAAG    139500
     GTCAACGGAA ACCGGGATCG CCTCGACACC TAATCTAACA GCCTCGGTGG CCGCATCGTT    139560
     TAGGCGTGCC ACGAGCTAAT AACGCAACGT TATAGCCCTT TTTGTAAAAC GCGAGTGCTG    139620
     TAGCTCGTCC AATACCAACT CAAGTAAACT ACGACTGTAT ATATTATCAC TACAAATCAT    139680
     GTGTCTTCTC TATTTATATT ATAAGCTATT AGAAATACTA TAGTATTAAA ACGCGGTTCT    139740
     GGCTTTTGCC GATACGCTAC CTCCGATTCT GACATACCAT TTGTCCCTCA ATAGCGCGTT    139800
     GTTCATGGAA CGGTCTTGTG GTGTCGCGGT TTCCAAAGGA ACGCGACAAA AAGCAAAAGA    139860
     AAGCTCCATT GGCGTGAATT AACAGGATCG AGGCAATTGA AGCTTCGCGG TCAAACGCCC    139920
     TTTGTCGATT TGCATGGGAT GCGTGCCGAC TACGATATTG TAACTCCGTT ACTTTTAGAT    139980
     AGGAGCCTTG TTCATGAAAC ATTTGATTTT GGCGATCGCA TATCTCGTGT CCATGAGCCC    140040
     TGTTTCTGCT CAGTCACTCG GCGAAAAAGC CGGTGTTAAT TCATTGATGG ATGCCAGCCT    140100
     TTCGACTGAG GATTTCGTCA AAGAAGCAGC TACGAGTGAC ATGTTCGAAA TTCAGTCGAG    140160
     CGAGCTCGCA CTGCAGAAGT CAACGGATAC AGCGATCAAG AATTTTGCGC AGCAGATGGT    140220
     TCAGGATCAT TCAATGACGA CGAGTGACCT CAAAGCTTTT GTCGAATCGG GCAAAGTCAA    140280
     AGCGACAATT CCAGATCAAC TGGATCAATC ACATCAATCC AAACTCGATA AGCTTAAGAC    140340
     GCTCACTGGA ACGGACTTTG ATAAACAATA TGACAAGGAT CAAACCACCG GTCACAAGGA    140400
     TGCGGTTTCC CTCTTCAAGC GCTATGCAGA GGGTGGGGAG AATGCCGAGC TTAAAATCTG    140460
     GGCCTCTAAA ACCCTACCCA AGCTCGAGGA TCATCTGAAA GAGGCAAAAG CATTAAGGCC    140520
     GTAGTCTTGA ACAATGATCA ATTAACCGTC CGAACCTTTT TTTGTAAGTC GCATTGTGGC    140580
     TTGATCTACA CCGACGAGAC CTATGTGAAG AATTAAGCCT TGTGTCTTTG ATCGTATAAG    140640
     GAACGAACAC AATCTCTTCC TGTTAGGATG GCATTCGAAA AAACGTTTTG GAAGTACGAT    140700
     CAACTTTCCG GCTTCAAGCT GTCAATCAAG CTACGCTGTC GGCTCCTAAA ACCGAGCAAA    140760
     TTGGATGCGC CTGGGATAGT CCTTTCCTGA TTTTTGGACG AATTGTCATG GACGAAGCCG    140820
     GATTTCGCAA TTTCACGGTT AATTTCGGAC CCCAGCATCC GGCTGCGCAT GGTGTTTTAC    140880
     GCCTCGTGCT TGAACTTGAC GGTGAAGTGG TCGAACGCGC CGATCCGCAC ATCGGCCTGC    140940
     TGCATCGGGG TACGGAAAAG CTGATTGAAT ATCGGACCTA TCTGCAAGCG CTGCCCTATT    141000
     TCGACCGGCT TGACTACGTC GCTCCCATGA ATCAGGAGCA TGCCTTTTGC CTTGCAATAG    141060
     AGAAATTGCT CCAAATGCCC GTGCCAAGAC GCGGTCAACT CATTCGCGTC CTCTTCTGCG    141120
     AAATTGGACG CCTTCTCTCC CATCTTCTTA ATATCACGAC CCAGGCTTTG GACATTGGTG    141180
     CTCTGACGCC ACCATTATGG GGCTTCGAGG AGCGCGAGAA GCTCATGGTC TTTTACGAAC    141240
     GTGCATCAGG TGCACGCATG CATGCCAATT ACTTTCGTGT TGGCGGTGTC CATCAAGATC    141300
     TACCGGAAAA ACTTTTGGAC GATATCTGGA ACTTCTGTGA ACCCTTCCTC AAAGTCTGCA    141360
     ATGATCTCGA AGAACTGCTG TCATACAATC GAATTTTTAA GCAGCGTAAT GTCGATGTCG    141420
     GCGTCATCAG TCTTGATGAA GCTTGGACAC GTGGGTTTTC TGGCGTTATG GTCCGGGGCT    141480
     CCGGCGCTGC TTGGGATCTA CGCAAGGCGC AACCCTATGA ATGCTACGAT GAGCTCCAAT    141540
     TCGATATCCC TGTCGGCAAG CATGGTGATT GTTATGATCG CTATCTGATC CGCATGGAGG    141600
     AAATGCGACA GTCGGTCCGC ATAATGAAGC AATGTTTGGA AAAATTAAGC TCTGTCGACG    141660
     GAAAAGGTCC GATCATCGAG CAAAACCACA AAGTTACACC ACCTCGGCGC AGCGAAATGA    141720
     AGCGTTCGAT GGAAGCCCTC ATCCAACATT TCAAGCTTTA TACAGAAGGC CATCATGTGC    141780
     CAGCGGGTGA AGTTTATGCT GCGGTTGAAG CTCCAAAGGG AGAGTTCGGC GTTTATTTAA    141840
     TTTCCGACGG GAGCAATATC CCCTACCGTT GCAAGATCCG CGCACCTTCC TTTGCGCATC    141900
     TTCAAGCGAT CGATTTCCTA TCACACAAGC ATATGCTCGC AGATGTTTCT GCCATCATCG    141960
     GCTCGCTCGA TATTGTCTTT GGGGAAATTG ATCGTTGAAA AAAAATTTAT CATTAATTTT    142020
     TTAACTCCTG CAACATGCAC AATTCGCAGG ATCGTCGTAA ACTTGTATGG GCTCTGTAAC    142080
     ATCGAGATGA TGTTCGACCG CTTTATCTAA CTTAATCAAG CCAGACAGTG TGGCTTTGGA    142140
     CAATCCTCTT GAAGGCGGCT TTTGTTCAGT CGTGTGATCC ATTCCATTGT ATTTCTGGAA    142200
     GTTCGAGGTC TATCGTACAG GTCACACCCT CCGGCAGAAA ATTTCTTTTA ACTGTGGCGC    142260
     CAGGCACGCC GTTCTCGATC AAAATTCCAC CAAATCCTCG ATTTTCCGGC GCAACCACGC    142320
     GGGGACCATC ACATTCTTTC CAATTGACAC TCAGATACTT GCGATCCCCC CTTGCAGACA    142380
     AAGTCCAGCT TAAAACAACC CTGCCCGTTG GAGCGGATAA AGCGCCGTAT TTCACGGCAT    142440
     TGGTCGCAAG CTCATGAAGT ACGAGGCCGA ATGGCGTTGC TATTTCTGGC GGCAAGATGA    142500
     CAGACTCGCC TTCGATTCGA AGTTTACCTG AATCGTTCCC GATATAGGCC TCTAATTGTC    142560
     CTTGCGCCAA CGCGCCAAGT TCAGCACCTT CCCAGCGCGA CTCGACCAGC AGCTTATGTG    142620
     CATTCGCTAG AGCGTGCAGC CTTCCCTCGA AGCGTTCAAC AAAATCGGCA CCTGATGTCG    142680
     TCGTGCGCAG TGTCTGATGT GCGATGGATT GAATCACTGT CAGAGTATTT TTCATGCGAT    142740
     GCGTCAGTTC ATCCAAAAGA AGCTGACGGC GCTGCTCCCA ACGTTTGCGT TCTGTAAGAT    142800
     CCCATGTACT TTCCAATACT AAACGGCGTC CGCCAAGGGA AACGAGTTCG ATTTGACTTT    142860
     CCACGCTCAA AACGTTTCCA TTCTTTGCCG TGTGGAAGAG TTCTCCGCTC CAACTCCCGT    142920
     TCTCGAGGAG GGATTGTCTC AAAGCCTCGA ATGAGGAGCC TGGTACAATG GTTTTAAGCA    142980
     GGCTCTCTTT TCTTTTCCCG ATTGCTTCCT CTCGGGAATA GCCGTAAAGC TGTTCACAGC    143040
     CGCGGTTCCA TTGAACGATG CCATTATCGA AATCCCAAAC AAAGATCGGC GCCCGCGATA    143100
     ATTCGACAAG GCGCATTTCC TGTCTCAGAT GCTCTTCGCT TTCCCGCAGC GCCTCCTCGG    143160
     CTCTGAGGCG CTCGGTAATA TCGACAAAGG TTGCGACAAC ACCTTCGATC TTGTCATCGA    143220
     TCGTCCGATA GGGACGCATC CGCACCAGAT ACCAGCCACC TTTACGACTC TTCACCTCCT    143280
     GCTCAATCGG CGTCAGATCC CTCAAAACCA TCCGTGCATG ATCAGCCAAT TCGTCATAGT    143340
     CCAGTTGATG CGTAAAATCG GTGATCGGCC GGCCTTCGTC ATGCGCGGTG ATGTTGAAAA    143400
     GATCCGTTAA GCGAGGGGTA AAGCGTTTGA TGCGCAGGGA AGGATCAAGA AAGAGCGTGC    143460
     CAACATCCGT CGCTGACATG AGATTTTGAA GATCATTATG CGCCCTGGAA ACTGTTTCAA    143520
     GCTTGAGTTT GAGCTCATTA TTGACGGTTT GAAGCTCTTC ATTGATCGAT TGTAATTCCT    143580
     CCTTGCTTGT TTCGAGTTCC TCTGACGTCG AGCGATATTC TTCATTGATG GATTGCAATT    143640
     CCTCGTTGGC GGCCCGCAAT TCTTCGTTGG TCGCTTCCGA TTCCTCTCGT GTCACCCGCA    143700
     GCCGGCTTTG CGCAAGCTGT AATTCTTGTT GTAATTGTTG AATCGTCTCA TTGACGGGTT    143760
     CGTGTGTGCG CGAGGTCCCG TTGTGTTCCT CGGTCACCTC TTGCTCAACG CTGTCCCCCT    143820
     CGATGAACAA AACAAGCGCA TAGGCAGTAG CATCATCATC CTGGACGACT GGCTTGACCT    143880
     GCAGATAGAC TCTGTGCGGC ACCCCATTGA ACCGGACAAC AAGGGGCATG CTTAAAGTTG    143940
     ATTCACCGCG CTCAAAGGCG CGATGCAGCG CCGTTCGTAG GTCGAAACGG AATTCCTCAC    144000
     GAACCATATC GGCGGCATCA GTGCTAACCG GTCCTCCAGA CAGGTGCAGA TAGCGCCCAG    144060
     CGTTTTCGGA CAGGTGAATG GCGCGGTGCG ACATATCAAC CAGCATGCTG GGCGGTGCAA    144120
     TCTTCTCAAG CATCTGACGG TGAAGAGCGG CATCCGCGAT ATTCCCGCCA TGGGAGGGAA    144180
     CGCGTGTCGT CGTTGGTCCG CGGTCGGCAA TTGGATAGGA ACTCAGCAGG ATGGGCAAGG    144240
     CTGGCCGCCG CTCGTTCGGT GTTGGGACCG CGCGATAGAG GCGGGCCTCG CGATCGATAG    144300
     GGCGGAACAA TCCGCTAGGC TGCTCCGCGC TTTCAGAAGA GCCAAGAAAT AAGAAGCCAC    144360
     CGGGGTTGAG GGCGTAATGA AACGTATTAC AGACCTGCTG TTGCAATTCG CGATCCATAT    144420
     AGATCAACAA ATTGCGGCAT GAGATCATAT CTAACCGGGA AAAAGGTGGG TCTTTGAGAA    144480
     GGCTGTGATT GGCGAAGAGC ACGATGTCAC GAAGCTCGCG ACGAACACGG TAATGATCGC    144540
     CTTCGCGTTG AAAAAAACGT CTCAAGCGTT CTTCCGTAAG GTCCGTTTCG ATGGTTGCGG    144600
     GGAAGCGGCC TTCGCGCGCA ATGGCCAAGG CACCGGTGTC AAGGTCAGAG CCAAAAACCT    144660
     GAATTTCGGG CCGGATCTCA TGGCGGCTTG CTTCCTCAAG GAGGAGAATA CCGATTGTAT    144720
     AGGCTTCTTC TCCAGTCGCG CAGCCCGGCA CCCAGACGCG AATTGTACTA CCTGCCTCTT    144780
     TGCTTTCGAA GAGCTGGGGG ATGGCAGTTT GAACGAGTGT GGCAAAGGCT TTGGGATCAC    144840
     GAAAGAAAGT TGTCACCGAA ATAAGAAAGT CGCCAAATAA AGCCTGTGCT TCTTCAGCAT    144900
     TGTCGCGCAG ATACAAATAA TAATCAGCCA GTGATTCCTT TCGCATAACC TGAGCGCGCC    144960
     TTGCGATACG GCGTAGGAGG GTTGCGCGTT TATATTGTGA AAAATCATGA CCGGTTCGGA    145020
     TACGAACATG GGCCAGAATA CGTCTGAGTA GATCTTCGTT CTGCTCTTGA GGAGAAAGGA    145080
     GTGGTACCTG TGTATGATGC GCTAGCAGTT CGTTCAAGCG CTTGGCCAAG TCTCGCACGG    145140
     GAAGAACGAA ATCAGCGACT TGTGTCGCAA TGGCGCTGCG TGGCATAGAC CCATATTCAG    145200
     CTTCTTCTGG ATCCTGAACC AGCACGATGC CCCCGGCTTC CTTGATGGCC TTGACCCCAA    145260
     TGGCGCCATC GGTTCCGGCT CCCGTGAGAA TAACAGCATA ACAATTGCTG TGCTGATCAG    145320
     CCAAGGATCG AAAGAACCAG TCGATGGGGG CCCGCTGACT GCGCGGTTCG TCGAGTGGCA    145380
     GTGCCGTGAC CAGATGGTCG GCAATATGAA GCCGGCGGTT TGGGGCGATA ACATAGACAT    145440
     GGCCGCCTTC AAGAAGCGCC GTATTATCAA TCTGTGCCAC CGGCATTTTT GTATGATTTG    145500
     CGAGAATAGC CGCGAGTTCG CTTGGGACTT CTGGATCAAG ATGGACGATG ATCACGAAAG    145560
     CTGCATCGGT TTCGGTATGA AGGGCTTCAA AAAACGTTTG GAGTGCCTTC ACGCCGCCCG    145620
     CTGACGCGCC AATGCCAACG ATTGACAGAT TTTGATTGTG ATCTTCCATT CCCCCAAGCC    145680
     TCATAATCTA AAGTGTTGCT GATCTCGGTA GAATGCCTGG TTCCAGAATT GCTGCTGCTG    145740
     CCGTGCATGA AAATCGAGTT GATTTTTGAG GATTCAAGAA AAGTTTTTTA AGAGAAATCA    145800
     TATTCATAAG TTAATTCAAG CTATCTACGG GAGAACTAAA AATTCTTTTG GCAGTTCTGC    145860
     GGCATAACGG AGAGAATGCC CATGAGCCAG CGTGACATTA TCGCTATTGG AGGATCCTTG    145920
     GGCGCGGTGG AGGCGGTGAA AAATCTCTTT CGCGATTTAC CACCTGGTAT CGATGCAACA    145980
     ATCTTGATCG TGATCCATGT CGGCACAGTA GGAAATAATT ATCTGGCCGA TATTTTTGAC    146040
     GAAGAAGCCT CTATTCCCGT CACCATGGCC CGCGACGGCG AAAAATTGAA GCGGGGCCAT    146100
     GCTTATGTTG CTCCGGCAGA TCACCACCTT CTCGTCATGG GCAACCACAT ACGATTGGGC    146160
     CGTGGCCCGC GAGAGAACAT GGCAAGACCA GCGATCGATC CGCTCTTTCG ATCCATTGCT    146220
     GTCAGCCACG GGTCGCGAAC AGTGGCTGTT GTTCTGACAG GTCTATTGAA CGACGGGGCT    146280
     GCGGGCCTCG CTGATGTAAA ACGATGTGGC GGCGTCACCG TTGTACAAAA TCCACGAGAA    146340
     GCAACCGCTC CGCAAATGCC GCTAGAGGCT CTCAAGACTG GATATGTTGA TTATATCATA    146400
     CCCCTTGAGG AATTGGGAAA TCTCCTGAAA AAACTAACAA AAGAAGAAGC TGGGCAATCA    146460
     AACGAAATTC CTGAAGGGCT TCTTTTCGAG GTTGAGATCG CGCTTGGATA TAAAACAGGA    146520
     ATCAAGAAAA ATGCAAAAAT CGCGGATGTC GTGCCTTTAT CCTGTCCAGC CTGCGGCGGC    146580
     GTTCTCTCTC AATTGAAGAT CGGATTACCG TTGAGATTCC GCTGTCAGAC CGGCCATGCT    146640
     TATACTGCGG AAACGCTCAT AAATGTCAAG GAAGGAGCTG TCGATGAAGC TCTGCGCGTC    146700
     GCTCTACGCA TGATAGAGGA GCGGGTATTC TTATGCGAGA AAATGGCGGA GGATGCGCGC    146760
     CGCAGTGATC GACATGCGGC AGCCAAGATC GCGGAGGAGA GGATGCAAGA ATATAAAGAC    146820
     TACGCGGATT TATTACGCCG CACACTCTTG GGGAAGAATT ATTAATGGGA CTATGACGCA    146880
     GCCGCATTTT TATGCTGTAT CCTTTATTGT AATCGCAATC TCTGTAATAA CTTATCCATT    146940
     GTCGTTTCTT TTTTATGGCT CCGCATTCCG GCAAGAAAAC AGAGCCACCT CAGAACCTGC    147000
     ATCTATGACA TGCATGATCG CGCGCCTGCG TCTCGTGGGT CAGCCAGAGT TTCAACTGGC    147060
     GGCGACGTGA AGGCCGAGGC TTGACCAAAC GCACAACTAT CCGCCATCAA GCGTATGCCA    147120
     AGCCTCGTCC GATCCTTCCT CAAGGCTTCA GATGTCGCCT ATATTACCGA CTTGTGAGTA    147180
     AGTGCACTTG CTGATGAGAT TAATATATAA ACTCAACGGC TTATATTATT ATTAGTACAC    147240
     AGAGTGAAAC AGAATCAAAC ATCGCCGCCT GACCTAACCC CGTCACCAAA ATTCAATCAT    147300
     AGCTCCCATC CCACGTCACG CCAATCACCT TGGCACGATC TTGCTTAGCA TGATCTTCCT    147360
     GGCCCAAGGA AACCAGACCG AACGATCACC GCATCAGAAT CAAAGAAGCC GCGAAAGGCA    147420
     AGAAATTGAT CCCGGCTCTT CAATCAGTCA GGGTATACTC CAAAAGAAAG GGCCACACGT    147480
     CGCGGAACAA TCGCTGCAGA CAACAATTTT CTGCAAAACA ACAAGAAATC AGGAGGATTC    147540
     CCATGCGCGT CTATGCATTC GTTATCTTTA CCGCAGCCTT CTTCGTCCTC CCTATCGCAA    147600
     CCTTTGCTCA AGAAGTTGAG CTCGGACCAG GGGGTGTCCG GGTGGAACCT TTCCACCAAG    147660
     GCCGGTCAGC TTGGCACCCG AACTGCGGGG AGTTGCGGCG AGCATGCCTC TATAAGGAGG    147720
     AACTCGGCGA GGAAGGCCGC GGTAATTGCG AGAGGTATCG CCACTTTTGT AGAAGCCACT    147780
     AAGAACGCCT AACAAAACCA ATTGGTCTGC CATAGACATA TGATGGCACA AGCGATGGTG    147840
     GTGAAGGCAA GATAAATGTC AGCCCTTCGT TCGTACCGTT TGCTCAATCG TCGAAACTGG    147900
     TTCATCCAGG CACGCGTGCG CTCGACGACC CAACGATGAC GCCCCAGCCT TTGGCTGCTG    147960
     TCCTGCCCGC GTCGGGCGAT GTGCGGTTTG ATGTGACGGC GACGGCAGTC GTCGCAGCAG    148020
     CGTCGATGGT CATAGGTCTT GTCCGGCATG CAGCTTGTCA GCCTCTAGCG TGGGTGGCCT    148080
     GGCCGACCGT TGCGCAAGGG TGGAACAGCG TCCAGCGTCA AGGCGAGCAT CTGGTGTCGT    148140
     GCTGATTGGC GGTGCCGATC AGCACACCAA GCGGCGTGCT GCGCACGTCG ACGACGAGGT    148200
     GGCATTTAGT GGCCGGCTGC CTCCGATCCG TCGGGTTGGG ACCTGCCACG CCGCCCCTGG    148260
     ATCCGCAGGA CTGATCAGGT CCTGGGGATG GGGTTACGTC AGTGGCGTCG TCATCAGTGA    148320
     GACGCCAGAG CCTCGCCATC GATGACGACG CCACTCGCGA CATATTTCCA TAGCGTGATC    148380
     AAAAGCTTAC GGGCTAATGC GAGATCGCCG TCTTGCGGCT CCGGCTGCTT TTCGCGCCGA    148440
     CATGTTCATG AAACCACCGC GCCAGCGCCG TCTCGGGCTG GTAGCGCAGC CACAGCCAAG    148500
     CCAGCTGGAT CATGATCGTG CGTAGACGCG GATTGCCGGA TTTCGATACC CCCTGTTCGC    148560
     GATCGATCGA TCCGCTCTGC CATGGTAAAG GCCAATCCGG CATAGGCGGC CACCTTTTTG    148620
     CGGGAATCGA GGCACTGTCC AGCGACGCTC CGGAAGCTGG CGGTGCAAGG CCACCCAGAC    148680
     ACCAGCCTGC TGCCAATCGC GCAAGCGGTG CCAGCAACTC ATCCTCGAGC CATAGCCCAT    148740
     CTCGACCGGC AGCATCTCCC ACAGCAGGCC CGATTGGAGA ACAAAAAGGA TGTCGGTCAG    148800
     CACAGCCCGA TCCGGCAACC GAGGACGGCC ACCCTTCGGT TTCGGCAGTT CGGATGGCAA    148860
     CAGCGTCGAA AGCGCCGCCC AGAGTTCATC TGAAACAAGA GCTTTGGCCA TGCCTCGATA    148920
     ACGCGCCAAA CCCCGTTTTG TCAAAACCTC GGTTCTAACC ATATAACTAT TTTATTTAAC    148980
     TTGGTCATAA TGGTTTTTGA GAGGTGATCT AAGTGCCTGA ATGATCAGCT GAGCCTCAAA    149040
     TGGCGTCCCT TGAAATCACA ATTGGATTTG TTGCGCTTTA GCCCAAAACG CTGGCGAGCC    149100
     AGAAGCGGCG GGCGCTGTTG ACGGCACGTA TGTTGCTGCA GGAAAAGGCA ATCGATATCG    149160
     AATGATATCC GCGGTCTTTT GCGTAACTTC GAGCTCAAGG TTGGCGTCGT CGGCGTTGTG    149220
     AAATTCGAAG AACGGATCCT TGAGTTGGTC GACGGCATGC CGGAGCTTGC CGAGATCATG    149280
     GCGTCCTTGC TCAGTGCCCG TTCGAAGCTG CGCGAGCAGG CCACGAAGCT GCATCGAAAA    149340
     GTGCTTTCGA TCAGCCGTGA AGATGAAGTG TGTCGGCGAT TGATGAGCAT TCCGGGCGTT    149400
     GGCCCGACCA TCTCTCTGGC CTTCACCGCG ACGATCGATG TCCCGGCCCG CTTCCCCACT    149460
     CCAAGTCTGT TGGGCCAGCC TTGGGTTTGA CGCCGATCCT TCATCAATCT GGGGAGAGCA    149520
     GCCACATCGG CCGCATCTCA AAATGTGGCG ACGCCATGAT GCGCACTTTG CTCTTCGAGG    149580
     CGGCGCAGGT CATGCTCACC CGGACCGTGA AATGGTCCTG GCTCAAGGCT TGGGCTATGA    149640
     CCATCGCCAA ACGGCGTGGC AAACAAAAAG CCATTGTCGC CTTGGCCCGC AGGCTGGCCG    149700
     TGATCATGCA CCGCATGTGG CGTGATGGGA CAGAATTTCG CTGGACGCGA GAGGAAGCTC    149760
     CCTCATTCGC TTGAGCACAG CCAATGATAT ACAAAGGCGG AGGAAATTAC ACCCTGCATT    149820
     GCTGAGATGT CCCGTCGCGG GACGATGGAC GAGGCGAGTT CGTAACTGGG TTTGTCCCGA    149880
     TCGCTTAGCG ATCAGAACGC GAAGCAGATT GAACCGTTTC ATCCTTCTGA TCCCATACTG    149940
     GGAGAGCCGG AGCGCTGATC CCGAAGAGAA GAGTGGACCC GCGACAGGCG CAACAAAACG    150000
     AAAGGGACAG CAGCTGGAAA ACGCTTGACC TCACCCCGCC GAATAGAGAA GAGCCCAATT    150060
     ATCAGCATTC CAACAATAGT GGAAGTATCA GTATGATAAT ACATATTTTT TAAAATAATA    150120
     ATTACTTTTT ATGCAATATA ATAACAATAA TTGCCCTATC ATGCGTAGAA AGAAATTATC    150180
     CCTATGCGGT CGTGACAACC AGATCCAATG GTTCTGTGAC GGCACAAAGA GTAACGTCAA    150240
     TCGCCTATGG AAAAAACTAT TATCTTAAGT CAATCCTCTG CGGAGGAAAT CCGAGAAATG    150300
     TGGATCTGGA AGCGTCACTC CTTAGATTAG GAAAAAAACC TCTCCAGTTT TAATGGGAAC    150360
     AATCCTTGAA TTATATAAGA GTATAAATCG ATTTTTACAG GATTTATTAA GATATACATA    150420
     TGACTTTGCG ATCATATTCC CATCTATCGA GCAGCTGGAT AATTGGCTAT GAGCGCTTTG    150480
     GTTCCTCCTT TCACTTTTGA GACAGCGACA GCGAAAGTGC GTTTTGCAGA AGACGCCTGG    150540
     AACAGCCAAG ATGCGCACCG TGTCTGTCTT GCCTACACGG AAGATAGTCT TTGGCGAAAC    150600
     CGCACCGAAT TTTTCTCTGG CCGTGAGGCC ATCATCGCCT TTCTCCAACG TAAATGGACA    150660
     CAGGAATTAG ACTATCGCCT CATCAAAGAG CTTTGGATCT ATACCGAACA CCGTCTTGCC    150720
     GTGCGATTTG CCTATGAATG GCGGGACATG ACAGGGCAGT GGTTCCGGTC TTATGGAAAT    150780
     GAAAACTGGG ACTTCGATGA GGCTGGTCTC ATGCGGCGCC GTTTTGCCTC CATCAACGAC    150840
     TTGCCGATCG CTGCCTCTGA GCGCAAGTTT GACTGGCGTT TGGGGCGAAG GCCCGATGAA    150900
     CATCCTGGCC TGTCAGATCT CGGGCTTTGA GGCAGCGGAA GAGGTCCCTA TTCCAAGCTC    150960
     TCTTCCATCT CGATAAAGCA CTCTCCGAAA CAGGCTTTGG TTCAGACACG TGACCCGGTA    151020
     CTGAGGCTGC CATCGAGATT GAAGCGAGGA TGATAGTCCA GGCCAATCCA GGCATGAAGC    151080
     ATATCGGCCC ATAGAGCAAC GCCTTCGAGC GCTTTGGCGA TCAACTGCTT TCCGCGAGGA    151140
     CTCTCGGGAT CGCACGCCTC AAGGAATTCC AGTCCCATGA TGCTGTGATG CTCGTCTGCT    151200
     TCGACATGAA GATCGAAATA AACGTCCCCA ACACCCAGTT CGTGCATTTT CGGCGCGACC    151260
     ATCTTGAAGA AGTCGTTTGA GCAGCGCTCG ATACCGCTGT TGATGGTCAC AAGCCACTTA    151320
     TCACGATCTT GTTCGGCCGC CAGCTGATAG GCGAGATTGA CGCACGCATT GGTTTCAACG    151380
     GCTGTGATCA CACCATTGAT ATCGGCTGCA TCCTGCAACA GTTCGTGTTT CACCATCCAA    151440
     CGCAGCAGCA TCTGGTGATG ATCAGCTTCA CCAAAGGCAT GTTTGGCATA AAAGGGCATC    151500
     ATGTAATTCT GCGACAGCGG TGTCAGGCCC AGCATGAGAC CCATGACCTT TGGGAAGGTC    151560
     GCCGAATGAA AGTAAAGCTG GGTGGCGACT GGCTTGAAAT CCTGCGGCGA CGTCATGTTG    151620
     GCGATATACG TATAGAACGG CATCCGTTTA ACGCTTTCAC TGGCCCGATA GATCGGCTCG    151680
     ACGATCCAGG CATATTTAGC CTCGATCGCA TCGAGCTTGA GTGCATTTAC AGCTTCATAG    151740
     GAAAAAGACT GTGTGGCGGG CATGAACATG GGTGTGTTCC TTAAAGGGAA AAGACAGGGG    151800
     AGGGGTGGTC GAGATCAGCT CAGGATTCCC TGCCAGGTGA AAGGGTTTCA GTACGTGCCG    151860
     GCAGGGAACT TGTACGATAC GTACAGGATA TGCGCAACAC AAAACGTACA GGTAATCTCG    151920
     AAAATGTTTT GAAAAATTCC GTGCCGGGAT TGGCAGACTA TTTCAATTAT TTGATAAATA    151980
     TATTCTTTTA TGAGTCCATA TAGGACTGCG CTTTGCCCCC TCCATTCCTC ATAAGAAAAT    152040
     CTCGTGAATA AAGGCCGCGC GCTCTTGTAC GTTTTACGAT TATCTGTACA ACTTGCACAA    152100
     AATCATAGCA TGATGAGACA TGATGGAATT GTTTCACCGC CTGCGGCGCG CGCGGAAGAA    152160
     TGCCGGCTTT CCCAGTGCAA CTGAGGCGGC ACGAGCCTTT GGCTGGAACG CGAACACCTA    152220
     TCGCAGTCAT GAAAATGGCG AACGAGGGGT ACGTATGGCC ATGGCCGAGC GCTATGCCAA    152280
     GGCATTCCGG GTCTCCGTTC CCTGGTTGCT GACCGGCATG CCGCACCCAG ATGCGCGCTG    152340
     TGTGGCCTGC CTGGCTGGCC GTGTCGTGGC GCAGGGCCGG ATCGAAACGC ATCGGCCGGG    152400
     AGGATCGCCT CTCTCCTGCA AGAACATCAT GCTGCCTTAT CCGGTTCCAG AGGGTGCCCT    152460
     GGTTTTCGAG ATCACAGGCG ATCATCTCTG GCCGCGCTAC GAATCAGGTG ATGTGGTTGT    152520
     CTGCTGGAAA CCGGCACGCA CGCTCCAAGA GGCCGATGGC TGGGAGGCGG CCGTCAAACT    152580
     CGCGGATGGC CAAATCTATC TGAAGACGGT TCGTTATCGC GAGGGTCATC AGGCCGATCT    152640
     CGTCAGTCAC AACAGCGCTC CCCTGGTCAA CAAGCATGTG ACGCATGCAC AAAAGGTTTT    152700
     CGGCAGCATT CGTGCCGATG CCTGGAGTGA GCTGCCACAG GCAGACAGCG AGGATGGTCT    152760
     GCAGGGCGAT GTCTAAACCC AGTGCGGTCG CGCAAGCCCG GGATCAGTTT GGATATCGCT    152820
     GCACAGTTAT AAATGCTGGC GCGGAACGCA AATCTTCAAA CGCTGTCCAA AATTCTGCAG    152880
     ATCATCGTCC TTGAAATGCA GTGCATGACC CAATTTCCAA CCTACAGGCT GCGCAAAGCC    152940
     ACTCTTTTGA GCCGATCGTC TCATTTTGGC CTGAGAGGCC TGGGGAGCCA GAGGTCTCGA    153000
     CCCTCAAGAC TCACGATTGC TGCCTCCTTG CTGGAGATGA ACCTGAAAAC GATCCGTCAA    153060
     GCGCTGAATG GGCCAGATGT CCCCATTGAT GCGGACCATG ATGAGAGCGC CTTGCAAATC    153120
     GGCCACCAGG GTATCCGCAA TTTCCAGGGC CTCTTCGGCC CCATATCGAT CCAAAAGGAT    153180
     GGCGGTATAA GCCTCCTTCA AAGACAGAAA GTAGCGTTTG ATTGGCTCGA CGAATATTGG    153240
     TTCGCGGTGC ATCTGTTCGA TACCGAAGTT GATGAAAATA CACCCGCCTT TGCTGTTGGT    153300
     GAAATAGGCC TCGATCGCCT TGTTTAAGTT CGTCATCCGC TCGTGTGCCG AGACTTGTTT    153360
     GTCATAGGCA TAGTTCAAGA TCTGCGTGTC GAAGAGATTT TGAATATAGT CCATGACGGC    153420
     CAAAGCCAAC ATGGCCTTGT TTTCGAATAT GTCGTAGATC TCCTGCGGGA CGACGGAACA    153480
     GCGGGCAGAA ATCTCTTCGA TGTCGGTCGC GGCATAGCCG TCGGAGCGAA AAAGGCTGGT    153540
     GGCTACGGCA AGGATTTGTT TGGCCTGATT GTCAGTCGTC CACACGATAG TACTCGATAT    153600
     GTTTGTTTAT AATTGCCAGC CTGCGATAGT CGCTCTCATT TCGTCAAAAC GACGTTGTGC    153660
     GCCTTGATGA AAACGCGCCG TCCCATCACC ACGATAGGAG ATTATCGCCA TATAATAAAT    153720
     TTACTATTGA ATTCTAAATC TTTGCAGGCC CGACGTAATT TTGGCTTTCG GCACTCGGAA    153780
     CCGGAGCACG CAGTTGCCCC GGCTGCGGCA AGGTTTCGGC TATGGCACAG TTGGTCCACC    153840
     CGACGCATAA GGCATGCCGT CAGACACGTC TTTCCTGATC CACGCCGATC GCAATGTCAT    153900
     CTTTCAGAAT TTCATTGACG TGGCTGATCT TCTCAAATGA TTGAATTTTA CCAAGGTCGG    153960
     CGAACGGACC GAGAGCTTTT CCAGGTAACT ATCTCAGGAA AAGTCCTCCC AAGAAAAAAC    154020
     GAAATTTACC CTCTCTTATG GCTTCGCGCT GTTGCTGGGC CTACAGGTTA CGCTGGCATT    154080
     ACCGGTTAGC CGAATCCACG CTTCAAGCGA CAAAGGGGGA AGCGAAACAG GCTTGCCACT    154140
     GTGCAGTAAG AAGCGGCAAT GTCAGCATTT CCAATGCAGG ACGATAGTCC GTAACCAGAG    154200
     ATCGACGCCT TATCCGCCGG GCTGAATATT GTCAGGCTCG AAGGCTCCAT TTGCCACCGT    154260
     CCAGATGAAC CTTGCCGGCT CCCTTCAAAC GCTGCAGGGC GACGGAGATC GTCTGCTTAC    154320
     TAAGATCGCG ATCGGCGCGG ATCGCCTGCT CGATTTCCGC GCGGGCCAGA GGACCTTCTG    154380
     CCTCGAGGAG GGCCAGCACG GCATTCGGCG TCGAGCCTTC TCGCCCTTGT GGCTCAGAAG    154440
     GGCGTGCGGA AAGAAGAGAA GCCTTTGTTT TCCTCGGCTT TTGGCTTTTC ACCGCAATCT    154500
     TTCGGCTCTC ACGATGGACC GGCTTGCGCG AGGCTTTGCC TTCGAGTTCC GCCAGGATCT    154560
     CTTCCACCAG GCGCAGATTA TCGATCCGTT CCTCGATCGC GGCGATTTCG GCTTGGATCT    154620
     GTTCAAGCGA TGATTGAGGC ATCAGTCAGT CTTTCCTTCA CAGTGTCCCA TGCCGCATAG    154680
     ACCAAATGAT CAATGGTTCC AAGGCCGTTT GCCCCATTTC GCCTCGCGCA AGGCCCAGAG    154740
     CGAGCGCTCG AGGAACAATT CGCCCTTCTC GGCCTTCTTG ACCATGCCAC CGAAATAGCC    154800
     GGCCGGGCCA CTCGAGAAAT AGTCCTCAGG CTTGACCGAA ACGAGCGCGA GCGCCAGGGT    154860
     CGCGTCTTCC CGGCCCATCA CCCGGCAGGC TTGCGCCCAA AGCGTCGTCG AAACACCGAG    154920
     GGAATGCCGC AAGGGGCCAC CCGCCGCGCC GATCACATCC GGCCAGTCCG GGGACGACGT    154980
     GCCTACCCAT TGGCCAAGCT CCGGAGCGAG ATCCAACAGC TCGGCCGGCT GCGTCAGCCC    155040
     ACCTTTCTTC CCGTTAGCCC CTTCCTGGGG CTTGGTTCTG ACCTTGAAGG ATGAAGCCGG    155100
     AGCCTCTGGT CTCGGCCGAC TACGTCTTTT GGAGGCAATT ACAGTATCCT TTGAAGGATA    155160
     GTGTGTTAGG GTTGTATTCG TATCTATGTG AGGCTCATTT TCGAGCCCCG CGGGGCTCGT    155220
     TTTTGTCTGT TTCTGCTGTT CACGTTCACT CTTGATGAGG TCTTCAAGAC CCGTCTGGAC    155280
     ATCCTGCATC TGACTCAGCA AATCACGCAG GTCTTTTGAG ACCTGCACGC GGCGGCAAGC    155340
     GAGATCGAGC CGATCGCGTT CAGCGAGCCA AGCGGTGACT TCCGGCAAGA CATCCTGAGA    155400
     GTCTTTCAAA ATGGCCTCGG CCTGGAGGAT GGCCTTGCGG ACGAGGGTAA GTTGCCGCCG    155460
     GCAGGAGCGG ACCAGGGCAC GTTCGATCTT TGCTTCTTCA GCGATACGGA GGAATTCCGC    155520
     ATACCGTTGG GCGAGGGGAG AGAGGTCAAA GCCAAAGGCC TGCAGGATGC GGCCATCCGG    155580
     ACCGCGCTGG CCATAGCGCT TGCCCTCGGC ATTGTCACGG ATGACGAAAA TGCCGGCTTC    155640
     GAAGAGGGCG CGGTTCAAAA CTTTCACCCG GGCGGCCGAG AGGCCGAGAT ATTCCTGCTG    155700
     CAGACGAGCG GAGGGCCAGG CGATCGGCTT GGATCCCTGC TGCCAGTCGC AGGCATGCGT    155760
     CATGTCAAAC AGCCAGGCGA CGAGCTCGAA GGCTTTGGGG GGCAGGCGGA GATAGGGGAG    155820
     CGCCTGCTGG AAGGCGGTGA GGAACTGGAA GGGTTTGAGG CTGCCGTCCG GCAGGCCTTG    155880
     ATAGGTATCG GCCGTCTCGC GGAAAGCGAG CATAGCAGGA CTGATCCGCC GCAAGCCCGA    155940
     GGGCCGCGGA GAGTGAGATA TTCCCGTGGA CATAGGTTCT CCGACATTGC GAGAACCCAA    156000
     CCAAAAAAGT ACGGTTCCGT CAGGCAAAAC GATCCCGTGG CCTAAAAATA AGGCTTGCAT    156060
     CGGTCTCGAT TTTCGGGGAA TATCTGGCTT GCGAGACACA GATTATTCCC CGGCTTTGCC    156120
     GGACAGGCCC GACCTTCTAG GTCGGGTTTT CTGTTTCTAT GGTCTTATTT CTCCGAAATG    156180
     GACTAGCCGC CGCTGGCATG AGTCCTAGTT CGATACTGTG CCGGTTTTTC ACGGCCGCGT    156240
     CCATGCCCTT TCAGCTATGA ATTGCAGGGG AGGGTCATTC CACAGCCTGA TCGTGGTGGG    156300
     CATGGTGATC ATGACGCCAC GCTGCAGGAT CTTGCACCGC TCCCTGCCAG ATGCCGCGAT    156360
     GCTCCGTCTG CGCTTTCGCT TCGAGGGGGA GATAAGCGGG CTCTGTCGGC CGACCGTAGA    156420
     AGCGATAGAC GACGGCCTGT CCTTCTTGCA CCATGGCGGC GCCAAGATCC GGAGTTTCCT    156480
     CCGTGCCGCA TTTCGCGAGT TTGCGCCCAT AGATATCGGG CTTGATGATC GTGCAGGTGA    156540
     CGGCTCGGCC GACGACATGA GAGGCGAGCC AAGTGGTTGC GACCGCGCCG CACGGCCAGG    156600
     CCTGACCAAG ACTGGTATAG GCGTCCTGAT CTTTTTCGCA GGCATCGATT CCGAAGAGCC    156660
     GATAGGACTG ACCGTCACGA GGATCCCGGA ATGTGTCTCC GTCGATAACG CTTGCCTTGA    156720
     TGTCAGATAC AAGCGCCTGC TCATTGTGTT CGCTGATCTG AGCGTTTGCT GGGACTTGAG    156780
     TGAACGCAAA AAAGAAGATG GAACAGATTG CTTGTTCACG GAGAGGAAAG TTCATGCGCA    156840
     AGACCTTATG GCGAGTCGTT GAAGAGCAAC TTGCATTGGG AGCTTTTGGC CGGTGCATGA    156900
     AAATTCAAAT CAGAAAAAAG AGTCACACTT TCGCCGTCAT TTAGACTACC GAATCACTTC    156960
     GGTTAAATTG ACTGTTAATA ATCCATTTAC TGTGAAATCA ATTCCTCGTG ATATCTAGCT    157020
     ATTCGGGGGG CTCATTTTTA TAGAAATGCA TTGATGTCAG AGTGAGGAGA TGAAGATTCA    157080
     ATGACTTATA TTAGAATGTG TCGGGCCGAC TTATGTAAAT ATTTTTAAGG GTTTATGGAC    157140
     TTTATCGCGG CATCTTGAAA CAATAAGCGT CAGCTAAACA GCATTAAGGC GATCAAGTCA    157200
     GCTTGCGCGG AAATGGCAAA AATCCGGTAC TGCAAAAATT TTACAAATCG GGGAGGTTCA    157260
     GTTAGCGTGA GAACATAAGA TGAATCTTCA GCTGGTTGTT TGCCAGTAAG GTTTGCATAA    157320
     TAATAAGTTT CGTCTGTAAT ATTCAACAGT AAATACCGTT TTGACTTGCG TGTGTCGTTG    157380
     TCTATTGAAT ATAACTAGAG ATATAGAGAG AAAACGATGC GGGAAGAGAA GGATAAGGCC    157440
     GGCGTTTTCG ATATAGCACA CTACCCTGCG CAGCGAATGC CATCGACAAT CATTAAAGAA    157500
     GATGATGAAC TCATAAGAAT ATGCGAACTT ATTTGTGAAT TTAGTGTACA TTGGAATTAT    157560
     ACACTTAATA CCGACAATCT CGATACTCAG GGTGAGTCTG AAACTATTGA TTTATTGAAT    157620
     AGTAGACTAT TTCAGCCGTT GCTGCGAATT ATTGAATTGA AATCGTCTTC TGAATTAGGC    157680
     GTTGCTGCAA AAGAACAGGT CCTTGCCGCA TACAAAAAGA TATTGCCTCA TAATTTTATT    157740
     GATACTTATG CAGAGCACTT AATAAATTCA ATTAATAGCG ACATTAGATC GATAAGTTAT    157800
     AAATGACATG TGTTATTATA TTAGATATTT ACGTGATCAA CATCGTATTA TTAATACCGA    157860
     TGTTCCATAG CATTTTATGC GTCATTTTCT CATGAGAGAG CCATAGAAAC TTTCCATACG    157920
     TCTAAGAGGA GGTTTCATGC GCTCTATTCC CGTTGCTCTT TTCTGTCTCA TGCCATTTGC    157980
     GGCCGCTGGG TCAGATCTTT CAGAGCTTAA GCAGCCATCC GAGAGGGTGG TTGAGGAACC    158040
     AACACTCCCG CCACTGGTGC CTGGCTTAAG TGATCGACCC TCAACACCTT ATCGGTCTGA    158100
     AGGTATTAAT CCTGATCTAC CCGTGCTGAA ACACATTGCG GAATCGGGTG CAAAACTGTC    158160
     AGAGCTTGGG GCGATGCATG GTTTGCAGAG AGTGCTCGTT CGACGTGACA AGCAGTTCAT    158220
     GATTTTGAAT GTCACGCCTG ATGGCGAGGC AATTATTGCA GGCCTTCAAT CTGACTTCCC    158280
     TTTCGATGAG CTGAAAAAAT CGCTCCCAAT TGATGTGACG GAGCTTCAGG ATACGCACGC    158340
     TATCAAAGGG TTGTTCGTGC GGAACGGTCA TGAATTTCAG GTCCTGTATC TGACCCCGGA    158400
     TGGCCAGAAC GTGATTCCAG GCGTCATGTG GGATGCGACC GGCCACAACA TTACGCGTGA    158460
     TCAAGTGTCT TCGATCGAAG GAGCCATTCC GCGCGTCGAA ATCAAGAATG ACACTATGCC    158520
     GGCCGTGGCT GTGTCAGCCT TAGATGGAAA ACCCTCGCTT TCTGTTGTTA AAGAAACGAG    158580
     TTTTGGCACT TATGGCAGAT CGGGAGCGCC CAGGCTCTGG ATCTTTGTCG ATCCTCTTTG    158640
     CAGTTTTTCT ATAAGAGCCA TGGATCAATT GCGCTCTTAT GCGACGCGCG GAGAGATCGA    158700
     ACTGGCCGTC GTTCCGGTCT CGATTATTGA TCATGAAGAC GGTGGTAAAA GCACCGAACA    158760
     TGCGCTCTCA ATGTTGAGTT TGCCACGGGA AACGATGGTC GCGGCCTGGC GGAATGATCA    158820
     GTTGAACAAT CCCGTCGCAG CCGAGGCTCG GGATCGTTTG ACCATCAATA TGGCGGCAGC    158880
     CGAGGTGATC CATTTACGAG GAACCCCGAC CTTGCTTTGG CAGAAAGAGG ATGGATCAGA    158940
     AGGACGTCTT GATGGCCTTG CAAGTGATTG GGACCGTGTC ATTGCAAGTA TGAGGCATTA    159000
     AGATGGCGAT GTCTGATCAT GAGCCACAGC AAAAAGAGAC AGGTCTTTTT GGCCGTGGCT    159060
     TCAAAGGGTT GAAGCAAGCG TCTCTCAAAG CCATCCAATG GAAATTGATC AAGGATAATG    159120
     CACAGTTCAT CCATGAGCTC GGTGCCCTTC TTCGGCGGAA GAAGGATCAT CAATCGGGAT    159180
     TGGTGATCGG TGAGGACCGG ATGCTCGATG TGGCTGCGAC AGCGGATCTC TATCAGGTGC    159240
     CGGTTGAGTT CATTGAAGAC TTGATCATGA AGCGGAGGAG ACAGACGAAA CAGGCGGCTT    159300
     ATTGCGCCTT TGGTTTTGGC TGGCTGGCTT TCCTGTACTG GCTTTACCAA TCGCTGACTC    159360
     GGTCCTGGTC ATCTGGTCAC GTCATCGAGA CGCTGGAATT CGCGCCCTTT TGCCTTGTGT    159420
     TCTTTCTGAT CGCCTTTCGG AATGCGCTGC TCAATTATCA ATTGAGGACC GGCCATGTCG    159480
     CAACGGCGAT GGAATATCTT CGAACGGAGA AGGTGTTCTG GCCTGCCTGA CCTGACTCAC    159540
     AGATGAATAA AAAGGCCTTC GGTCATTGGA TCGAAGGCCT TTTCTTTTAG AATGTTCCAG    159600
     GCGGGGCATT GGAGGGGCCA CCCGAGGCTC CGGAGGCCCA TTGCGCATGT TCATAGTCAG    159660
     GCCGGCCGGC AGTCGTGGCG GGCTCGACAG GTTTGACGAT CGTGCGATTC AGGTTGATAA    159720
     CGGGTGGCCG CCAGGTGGCG TTGGACTCAC CGTAGGCGGC GGTGGGGTCG TAATAGGGAT    159780
     GCTCGACCCG TTGCGGCAAG GGAATGGTGT AATTGGAGGC GCCGCGGATG TTTGGCGGAG    159840
     CGCCACAAGC TGAAAGGGCA AGGGTACAGA GAAGGATCAA GGATAGAAAA AAACGCATGG    159900
     CAATCTCCTT TCGAAGATCA CCATGCGGCG GTCTCATGCG AAGGACTAAT TGTTACGATT    159960
     TTCGTACATC TGGTAAAGCC AGAGAGGAAT TTTGAAGGGA AGATCTTTGA CTCTGTAGCC    160020
     TTTATCACAG AGGTATTTTA CCGCGTACAT AAGGGTATTG CTTATGTCGG TGATATCATC    160080
     CCCTCGATCT CTATAACCCT TCAACGCCGA TTCCCCGAAC TCCTTGGCCT CCTTCAGTTC    160140
     TTTTTGCAGT GCCGATTTCT GGCGCTGGTC TTGCTCGTAA AGTCCATATA GCTTTTGATA    160200
     GTCCTGGTGC AGTTGAGCAT AGTTTTGGCG CAGAGCGTTG TTTTGCGCGA TGAGAGCATC    160260
     TACATCGATT TGCGGCTTTG GCGGTGAAAA ACGGGCACGG AGAAGTTGCC GAGTACGTGC    160320
     ATCACTTTCC GCGGATGCAC GTCCCATCTG ATACCATGAA TAATTGCCGA AAAGGCTGGA    160380
     ACCACCTTCT TCATCATCTT CCAGCATGGT CAGACCTCCT CATTGGGGGA ATTCTGTGTA    160440
     TCCGTCGCGG CTCGCAATGT GGAATCCATA CCATGTTTTG ACGCCGATGA CGATTGCTCA    160500
     GGTGAAGAAG TTGTAGGCCC CGTCAATTTC CTTGTGTAAC CGAGCTGTTT CTGGACAGCC    160560
     TCGCCGGCAC CAAAAGCACC TTCACGAAGA CCTTCCCGCA TGGTCGTCAG AGCTCCGCCG    160620
     ACACCAACCA AGGCCGCTTC CTTCGAGAAT TGGTTCATAT CGACTCTGTT GGTGGCCGTG    160680
     AAGCCAACGA GACGCGGCAG ATGGTGCGGG ATCAAAGTGA TCAGCCGAAA GGATGTCAAG    160740
     GCAAGAACGA TGTGGATCGT CACATAGATC GAGAGAAGGA CGCAGACGCC GAGAATGTTG    160800
     GTGACAACCC AGCCATTGGC GAGAACAAAT CCGGCCGCGA TCCCGAAAGA CATGCGGACA    160860
     AGCCAACTCA TGGCGGCGAA GATTGTATAA CCTAAGAAGA GGCCAAACAG CATCAAGACG    160920
     GGACGGAACA GGAGATTGAA GAGCAGGCCA TAGCCTTCGA TCGCCCGGCC ATGAAGTCCC    160980
     GCTCCTTCAA GCGTCATATG GGCGAGCATC CAGAGAGGGA CCGCGACGAC AGCCTCGCAG    161040
     ACGAGGATCA GATAACCGGC CACGCCCGCC ATCCACATGA CCCAGGGGAT CATCGGCAGC    161100
     ACAAAGGCGA TCGTGAGCCC AGGGATCAGC AATGCCAGGC AGGCGAGGAA AATAGGTGTC    161160
     CCAAAGAACT GAACCAGAGC ACTGCCGGCG ACGGACGCGG CGGCTCCAGC GAAGTTTAAC    161220
     GTCAGGATGT TCCAGGCCGT TGATGCGACT GTGCCAGTCG TTGAGGACAA AAGCCCTGCG    161280
     GCACCGAGAG CGGTGAGAGC GATGACGATG AGCTTGTGGC CGAGTTGCAT GAGCGAGCCG    161340
     AAAGGATCCG TCCAATTGTT GCCGGTCGGT GACATAGCTT CGGTAAAGTA GCTGAGAACC    161400
     CGATCGGACA GGTGAATGGA GCGCATGACC TGCTCAATGG CGCTGGCCCC GTCGCCTCCC    161460
     GGTGTTGCGC CCGAAAAAAG CTGAGCATTG CCGGTTGGTG CATCGAGCCC ATCGGTGGTG    161520
     GTCACGTAGC TCCTGAGATT GCTTAAAAAC TGCGTCTCGG CGGTCACGAG TGGAGCTAAA    161580
     TCGTTTTTCA ATGACTTACT CAAGCCTTCA AAAGAAGGCG GGCTGACCAT CGGCGTCGCG    161640
     TTCAAGAGGG ACATCGTTTG GCCATTGAGC CGAGCTATTT CCAGGTAATA GGCGCCGGCC    161700
     GAGGTCCAGC CCAAGGAATT GAGCTGCGTT TCATTGGTGA TGAGACCGAT GGAGCCTGCC    161760
     CTCGCTTGGG TCGGATCACT CAAGGCATTG CGCAGCTGGC TCGTGACCTG CGTCGCGGTA    161820
     TTGGTCAATT GCTGGGTATA ATCGGCCGTC GCGGTCTGGA AGATCTGCAA CAGAGGAGCG    161880
     AGGGCGGAAG CCTGCTTGGT CTGCCAGAAG TTCTGGACAA CCATTGGCAC GGTCGACCGG    161940
     ATATCCGCAT TCAGGACCGA TTGGAGGATC TGCTGTTGGA TCGCGGGCAT GTCGACGCTG    162000
     ACACCCGCGA GGTTCGTGGC GCCGCTCGAT TGCTGCAAAG TGACGGTGCC GCAAACAGGT    162060
     GTGCCGGTCT CATTGCCGGA AGCCAGGCCA TAGGCCCAGG TAATATAGGT CAGGGTCGCG    162120
     ACGGGTTCGC CTACGACAGG GTTCGGGATC GGGACGAGAT TCGGATTGCC GGAGGCCTGA    162180
     TTGATGAGGG CACGGCAGAA TTCGTTCTGG ATCAGATTGA TCACGGTGGT CGAGGTTCCC    162240
     GGGATCATCG GCTGGGCGAT GACCAGGGCG TCGGGGCCTA TCGCCTGAAT GGCATTGGCA    162300
     TAGACCGCTT TGGCCATGCC GATGCCCCAC ATGGCAGTTT TGACGACCAT GGCTTGCCCG    162360
     TTGGAAAAGC CGGAGGCGAG CGGGAACATC ATGATGGCGG CGAACCCGAT CCGCACGACG    162420
     CCCATCCATG TCATGGCATC GGTCATGAGC CGGGAGGTTT CGGCGACACG ATGGATGTTC    162480
     ATGATGAAAT GGTAGCAGAG AAAGGCCATG GCGATAGCCA TGACGAACCG AGTCAATTGG    162540
     CCCATGATCT GGCCAATGAC CGTGGTCGCT CCATTTTGGT TGATCGGAAA GATATTGTTG    162600
     ATGGCCTGGG CCGCCCAATC ATTCCCAGGG TCGAGAACGG CCCAGGTGAG AGCAGTGCCG    162660
     TTATTGGCGA TTTGAGCGAA AGCGGGCTCA AGGGCGAGGC AAGCAAAGAA CAGGGTGGCG    162720
     AGAGTGAACA AAAGGCGCAT GGCAACCTCA TCAGCATGGT GCCCGAGGAT GTCATGCGCT    162780
     CGTGCGAACT CAGCGTGCTG TTCTCACGGG CTGGGCCTGG GGCTCGCTGA GGCGCTGTGC    162840
     TCGGCATTCC CGGTGAACCG CTGGATCGCG CCTTGTATCT TTTCGACAGC CTTGCTGATG    162900
     GCCTCGCCGG CCTTCTTGGC CAGTTCCTCG AGGGCATTCT CGCCCTCTTT CCGTCCAGGG    162960
     AGGACTTCGG CTTTTTCTCC AACGGATGCA TCGACCTGTT GCAATTTGGC CGCGAGAGCA    163020
     CCGGCATCCG GCTGTTTCGC AATGACCGGC TCGATCGCTG CCCGCTTGTC GGCATAGTTG    163080
     GCGAGCGCCG ATGTCGCCTT GTCATAAGAG GCAGCGAGGT TTTTCTCGGT CAGCAAGGCT    163140
     TGATCGAATT GGCCGCGCAG GTCCGCATAG CGCCCGCCTG AGCGCATTTC GGAGAGGACG    163200
     CCGGCCATGC CTTCGGGTTT GGATTTTGCG GCCTGCTCGA TCTTGGCCAT GATGGCCCGG    163260
     CCAGGGCCAT TCGAGAACTC TTGCAGGGCT GCATTAGCGT CGGCTCCTGC CTCGAAAGTG    163320
     CTCTGGATGG CCTTTTCCTC GTTGCGCGGT CCGAGGACGT TGGCTTGATA GTTCGAGAGC    163380
     CGGTCGAACA GCGAAACCCG TTGGGCATCC GCGTTCTCAG CCTTCGATCG TTCGGGTCCA    163440
     AGATTGGAAA GGATTTCGGC CGCGGCCCCA GGCAGGCGCA ATTTGATGCC CGTGATTTCT    163500
     GGATCGGTGA AAATCTGATT GGCATCCTGG CGAGACGGGG GAGCGGCCTG ATTATTCGCC    163560
     TGAGTGGCAG GTTTCTCCGC CTGACGCTCG GCAGAGTTTA TTGTAGCCGC TGCAGCTTGA    163620
     GTTTGTTGGG CCTCGGGAAT TCTTTGGGCA AGCCGGGCCT CGTTTTCCAA AGTGGCTGCT    163680
     TTGCTGTTGG TTTCTTGCGT GTGTTGGTCG GGTAGAGTTG TTGTATTAGC AGCTTCAAGC    163740
     CGGATTTTGG TTACGAGATT ATGATCATCG ATATTTGGCG TATCCTTCAA CAAGGCCTGC    163800
     ATGCCTTCAT TACGAAGATT GGGTAACGTC GTCCCACTTT TCCGCAATTG ATCGCGTAAG    163860
     GCTTGCGGCA TGGACAGGAC GGCTCCCACC TTCTCCGCGT CCTGCACCGC ATAGGCGAGC    163920
     TTTGTGCGGA CGGTGGGATC ATCAAGTTTT GCGGGGGTGT CCGCGTCTTG CCTCAACTCC    163980
     TTGATGGCTT CGCCGAGTTT GTCTGGCAAA GCGCGGTTGG CCCGGATGAT TTCGAGCTGC    164040
     ATGATCAATT GACGAAGTTC ATCATGGTCT TCTTTTTTTG GCTCATGAGC ATCGGGCGAT    164100
     TTAGCTGTAG TGTCAGCCGA TTTGGGGGTT TCAGCGTCCG GTTTAATGGC CCCAGCGTCT    164160
     TTCCCTTCGG GTTTAACGGT TTCGGGTTTG GTCACAGGGT CCGGGCGATC ACTGGCAAAA    164220
     CGAAGGGGTT CTGAGCGGTC CCGTTCATTG AGATCTGGCA TGGAACTCTC CTGTTCTTTC    164280
     AGTTGGCAAC GATGGATGGG GTCGGCATGG GTGTGGGCTC AAGTGAGCGC TCGGCTTCGG    164340
     CGGCGAGTTG CGTCGCATTC GTGCTGGCGT TCATCATGCC CAGCCGATAA TTATGGAGAA    164400
     GCAGATAATT GGTGAGTGCG AGCTCTTGCG CGACTTCGCG CTGCAGGGCG GCCGGGGTCA    164460
     TGGCCATGAG TTGCGCAGCA TAGTTCAGCG AACCATAGCG GCGATTGACG TCGAGGGTCA    164520
     GACCTTGCAG CCAGGATCCG TTCTGTGTTG CCGGCAGGCC TTCGTCGGTC ATTTCCCGCT    164580
     GCTGTTCAGC CGAGAGCGGG ATGGATTGAG TCTGTGCCGC CATGACGTAA TCGAGCGTGT    164640
     TGCGCGCCAG CGAAACACGG GCATTATATT CCCGCCGTCT AACCCTTGCT TCTTCACCCA    164700
     TGGTCGATGT CAATTGACTA CCTCGCAGAG CCGCCGGAAC AATCGGCTGG ATCAGCGTCA    164760
     TGGCATAGGC ATTGGCGTCA TTGACGCCTT GCTGACCATT GTAGGTGCCT GTTCCAAAAA    164820
     GGCTCGAGGC GCGTTGATCG GCGTTTGGTG TAGCGGAAAG CTGGCAAAGG CCTGCATCAG    164880
     CTTCCGTTTG CGAACAGTAG AATTTGCTGT GGTAATCGTT GTTCGATGCG ATGGCTTGCG    164940
     CGGTTCCATA AAAGGCTGGG GTGTTCGCAT TCGCCTCACC ACGATTATCA TTGACGTCTT    165000
     GAATGGCTCT GGCGACTTTC CAGCTTTGAC CAGCCCCGAC GATGACGGTC TGGCCGTTAT    165060
     CCTGCCCCGC ACAAATCAGC GGGTTAATTG TATGTTGATC GCGGATCTGC GAATTCCGGA    165120
     CATCCCTCTG GAACCGGGCC ATGGCCGTGT TCGATGCATC GGCGATTTGC TGCTGTGCGG    165180
     AGATTTGGGC CTTGGAATAA TTGGCGTTTT GCGTGAAGCC TTTGAGCAGC AATTCCGTGA    165240
     CGCTGCCATT GACGGCGCTG CCGATCCCAT CCTGCAGGCT GGATATTCCT GAATTGACCT    165300
     GTTTGATGAC GCTCGAAATT GTGCTGATGA CTGGCAGCGT CGTCCAATCG ACCACAGGCA    165360
     TTTGTGCCGA AGTCGGCGCA GCGCCGAAGA CCATGGCGCC CAACACGAGG CCGACGGCTG    165420
     TCGAGGCTAG AGGAGAAATG CGCTTCATGG AAACTCCTAC CAAAGGCCGT TTTGTTGAGA    165480
     GACGGTGTAG CCCGCGGGGG CAACGCCGGC GCCATTGACG CGGAATTGCC CATTGCCATT    165540
     CCCGCTGACG CTGATCGAGC CCATGGGCGG GCCGCCGCCG CCAAAAGTCA GTTTCGGGCA    165600
     GCTCAGACCG CCTCCAAGAT TGCCGAGGCC GCCGAAGCCG AGATTAAAGC CGGTGAGTGT    165660
     GATGCCGCAT TGCGGCTGGC CCAAAGAATT CTGCCAGGCC GAGGAAATCG CGTTGCAGAT    165720
     CTGGCCCTCG ATCGATTGCA GAAGATTGGT TGGGTTGAGA AAATTGGTGA TGACATCGAG    165780
     GCCCGCGCCT TTGAAGAAAT TGTCGAGGCA GGTGAGGGTT TTTACGCTCT TCGGGGCATT    165840
     GATATTGGCA TCATCAGCCG CGATCCGTTG TGAGATGGTA TCAGCGGACA CTTGTACGAG    165900
     CTTGGCGCAA CCGGCAGTGC CGGTGGTCGT ATTCACGGTC TGCGCGAAGG CGGGCAGGGG    165960
     AATGGCGAGG CAGACAAGCA CCATGGGGAG AGAACGCTTC ATCACGCATC CTCCCGCATG    166020
     TGTTTGGTGA CGTCCTTGAG AAAGGCAACC CGCTCTGGCG CATAGATCCG ACGCATCATC    166080
     TTATCGCGCT TGTCCGCTTG TAAGGCGCGC GAGAGCGAAA GACTGGATCC CTTATCCTTG    166140
     CTGGTCAGCA GGGCAGCGGT GACGGCTCGC CGATGGGGCA GGCCGGGATG GGTCATGAGG    166200
     GCCAGAAGCT GGACTTTGCG ATCGATGGGG AGACCTTGCA GAAAATCCTG CACTTGATCT    166260
     CGCGTGGCCT GGCTCTGCAG GGCCTCCGAT AATGCTTCGG GCTTGCTCTG GCGTGCTCTA    166320
     TCGATCGCGG AGGCAAAGCG AATGAAATCC TCGGACAGAA CAGGATCATT CGCGGCTTCT    166380
     TCGAGCGGAT CGATGAGGTG GATGGGACCA TCGGCTGGCT CGAGCCAGCA TGGAGGGGCA    166440
     GGCGGGGAAG GATCGGGCAT GGAACGGCTC CGGTGGATGA TCCGGAGCAG GGTCGATAGA    166500
     TGTCGCGCGA AAACAAAAGC GCGTGCCTAG AGGCTTAAAA CAAGCGCTTG TCCCTTAACA    166560
     GATACATGAA TGCCCAGTGG CTGCACAGCT TCCTCCAGGA CGATCTTCCA TTCCCGCCCG    166620
     CCCCTCCAAT CGACCAGAAC GTCTGGTGTA ATGCCGGGAC CGAACTGGAT GGTCATATGA    166680
     GGAGGAACGA TCTGTTTGAG AGCAAAACTG AGGGGGATTT GCGATCCAAA TCCTATTGCT    166740
     TGCGCTTCAA GGGAGGATTT GGGTTTCAGT ATTGCGGTTT TATTCTTATT CCCTCCAGTC    166800
     TGTTGGGAAT GTTGAGGTTT TCTTTTGTTG AGAGATTTGG CTGGTTTCGG TTGAGTCTTC    166860
     TTGATGCCTT CGGCCGCATG AGATGCTGAG GGCAGAACTG TAAATTCGGC TTTGGCGGGA    166920
     GCACAAAGGG CGAATGACCC AAGAAGAACA ATAGAGAGCA ACGCACGCAT AGGTATCCCC    166980
     TTTCCATTGC TCTCAAAGGT TGTTGAAGCG CATGCAAACT CAAACGGGAT ATTTTCTGAA    167040
     TCGGTCTCGC GCGATTTTAA AGGAATAGCT AAAAAAGCAT GTTCTTCACG GACTAGCGAG    167100
     CGCGCACATG AGAGATTTAT CGGGGGAGGC TTATGCCGAG AAAGCCCGTT AACATAAACA    167160
     ATCTAGACGA TGAAACTCTT AAGAGCCTCG CAATTATTGG GAAAAAAATA AAAGATATGA    167220
     GGGTAGCGAA AGGACTCTCT CAAAAGGCTT TAAGCGGCAA GTCTGGCGTA TCACACCAAT    167280
     ATATATTGTT GATTGAGATA GGAACACAAA ACGCTACAAT AGGAATATTA AAACGTATCT    167340
     CTGACGCTCT AGAAGTTCCA TTTTATTCAA TATTACCAGA TGAATGGCTG ACTGGCGGCC    167400
     TTGATGAATA TGTACTCAAT CTTTTTGAGA AACAGTCATC CCATCTAAAA AAGGACTTTG    167460
     CTGATAATTC GATGACCGTT TCAATTCTTG ACAATATGTG GAAGAAATTT GATGAAGCTC    167520
     GAACTATGAT TGAAGAAGCG CAACGAGCAT TGGGGGACAT ATTGGAACGT GTGAAATCTG    167580
     GAAAATGAGG AAAGCCTATT AACATGAATT TCTGATATCT AATATTTTAG TTCTTGACTG    167640
     ATCTATTATA TTAGAGCGAA AGTCTGTTCC GGTTAAGGTC ACCGGAGCGG ATCCCTATGC    167700
     TGTTGCAGCC AAGCCTGCCA GGATTGGACT ATCTCGAGCA GGATGAGACG CATGCGTCTG    167760
     TCCTGTCTTT CACTGCCCCA CCACGCGCAT CGGTTCTCCA GTCGCTCGAC CTGATCCTGA    167820
     TGGGCATGGT TGGCGCAGGG CTCGGGATCG AGGCTCTCTG TCTCTATTTC GATCTCACGC    167880
     GAATTCAGTT GTGTGAGCGC TTGCTCGCGC TCGATCTGGA GATGCCAGCG GATAAACCCA    167940
     TCAGGCGGTT TGCCGGTAAA AATCCCTGGA GCGTCGAGGA TATACGCCAT CTCATCCGAT    168000
     GGTGGAGTGA TGGCATCCAT GTCAAAAGCA TCGCGCCCAG CCTTGCCCGT TCTGAGAATG    168060
     CGATACGCGC CAAAGCGCGA CGGATCGGGC TTCCACGGCG TGATCGCCGG CTTTTGTCAT    168120
     ATCAAGATCT TCCACCGCTA AAGCCGCTTC CTCTCGATGA GCCGTCATCG GAAAGCCTTC    168180
     AGAGTGACAT TCTTCCAGAA ACGCATTCAA ACCTCACACT CACGCCTCAG ACAAAACGGT    168240
     TTGGCGTCGA AATCTGGAAG AAAGAGCACG ATGATGATGC GTTGCTGCTC TATTTTGGTC    168300
     AGATCAACAA TGCCATGGCG GCCCAATATC TGAACGATAA ATGGGGCACT CACTATTCCG    168360
     CGGCGGCCGT AAGCTCCCGT TGGACACGCC TCGGCTGTAA GGGCCGAAAT CGCAAAGCAA    168420
     TGGCGGCGTC TTTCGATCCG GTCACTGCCG AAGCCAATTT CAAGGCATCC GGTTTCGTCA    168480
     AACGTCAATG TCATACATTG AAACGCGTGT TTGTCGAAAG GCGGGGCGTC TATTCCTACA    168540
     ATTGCCCCGA GGCACAAAAA CGCGTGGAGA AAATCACGAT CAGGAAGCCG CGCGAAACCG    168600
     TGGATCATTA TCGTCGCGGA TCGGTCAGCT TGCCTGTGCT CAAATTTCTC GAGCGTAATT    168660
     CGTCTCTCTA ATTCATTTTC ACGATTTTGT TTTCGCGCGG CAAAGCGGGA GCCTCATGCC    168720
     ATGCAAAACC AACGTGCGGC TGTCATGCGT CGTTTATCCG ATCCCGATTT TCAGGCCTCT    168780
     CTTGTCAACA AGAGCATCAT GCTCGTCATG GGCATGTTTG TCATGCAGGC CATCTTCGTC    168840
     ATCCATGATG TCTATGTGTG GATGAACCCG CCACAAAACA AGTTTTTCAT CGTGGATGGA    168900
     AAAGGGCCTC CGCATCTTGC GACTCCCTTG TCGAGCCCGG TTCGTGGCGA TCGCGAAATG    168960
     CTCGCCTGGA CCGTGGATTC CATCCTCGGC GTGTATAACC TGAACTATCA CGATTATCCC    169020
     GTGCAATTGA CGACGGCGGG CCGTCGCTTC ACGCAGAAGG GCTGGATCAG CTGGGCTGAC    169080
     AGTTACAAAA AGAGCGGTAA TTTCGACACC ATGAAACAGG CCATGCTGCT CTGTGACGCG    169140
     CAGGCCCAGC GGGCGGCGAT CATTCGCGAA AGCACAATGC TGCAAGACGC GCTTGCCTAC    169200
     AGGATCGAAG TTCCGATCGT TCAGACCTGC CGCAACTCGC AGCAAACCTC ATCACAAAAT    169260
     ATGCTGCTGA CCGCGCTCGT CGTCCGCACC AATTCCGAAG ATTATCCTGA CGGGCTCGCG    169320
     ATCGAGCAAC TCGTTGCCCG GCCTATGTGA GGAGTGCCAT GCCCAACCAA TTCAATTTAT    169380
     GGTGTTGCGC CAGCGCGCTG ATCCTCCTGT CAGGATCAGC GTTCGCGCAA GTTGTTGCCA    169440
     ATACGGGGAA TAATTCTCTC TCGCCCAATG ATGTGGAAGT CGGCCCCGCG ACGGATCTAC    169500
     CGGCCAACGC TCTCCCTCTT ACCCCTGAAA TGATCCGTGA ACTCGGTCGG CGCTACCGTG    169560
     AGATCAAGCG GGAAGAAGAG CGGGCAACGA CGCAAATCGC GACCCCCGTT AGCCGCAGGA    169620
     TCAATGTCGC CTTCATTCCC GGCCAGGCGA CGAATATCAT TCAAACGGTC AAGGGCTATC    169680
     CTTCGGCGAT TTCCTTCTTT GATAGCACCG GGCAGCCCTG GCCGATCGAG TGGAACTCCA    169740
     ATTCCAATCC CTCATCGATC GCGGGCGGCA GCAATTGCAA TGCCACGACC AATACGGGTG    169800
     GGCCGGCCGT TGCAGCGGTC GGTTTTCATG TGTGTACGCC AACAAAAGGT AGCAACGTCC    169860
     TCGAGGTCAC GCCAATGTCA CTGGAGCCGC GTGGAGGCCT GGTGGTGACA CTCGAAGGCG    169920
     CGCCGAAGCC ACTCTCCTTC ATGCTGGTCG GCGGCGGCGG ACGCTACGAT TCCGATGTTT    169980
     CTGTTCATGT CGCCGATCGC GGACCGCATG CAAAGGTCGA GATCACGCGG AGAACACCCG    170040
     CCCCGGATAC GGGCTCCGGC TTTCTGACGG CGATGCTGGA TGGCGTCCCC CCGGCCGAAG    170100
     CCACGCCGCT CGTCGTGAGC GGCGTCTCGC CCGAGGATCT TCGAGCCTGG AGGCTCGGCG    170160
     ATAAGGTGTT CTTGCGCACG CGCATGACTT TGATTTCGCC AGAATGGACG GCCTCGGAGG    170220
     CGGGCGAGGG TGGCCTGACG ATCTATTCCG TACCGGCAAC GCCTGTCGTG CTTCTCTCCG    170280
     GGCATGGCCG TACCGTTTCC GCCGCCTTGC AGGAGCAATG AAATGGTCGA TTTGAGCGCA    170340
     AGCCTCAGCA AATTCTTGCC GCGTAAGCCG GCCTTTTTGA ATGCAGGTGG AAAGGGGGGA    170400
     CCGCGGCGCC TTCTAGTCAT CGCGAGCACA GGGGTCAGCA TGATGGCCCT CGTGGTCGTG    170460
     CTCTCGTTGC AGAGCCAGAA GGACTCTCTC GATTCGAGCG TCACCAAGCC GCCTGCGATC    170520
     AATCCGAATC CTGGCGGCCT GCAGTCCGAT CCCGCCCAAG AAAAATTGCG GACGGTCACG    170580
     CAAAGGGAGC AAGCCAAAAA GGCCGAAGAA ATTGGCTATT CGTTTACGCC TGTCATGGCG    170640
     GGCAGTCAGC GCACGAAACC TTTGATCACT CCTGAATTCC CGGAGGTGCA GGAGCCCCCG    170700
     AAACCTCTTG TCGGAACTCC CGTCATCGCT CCCGTAACGC CGCCGAAGCG CGTTGTCTCA    170760
     CTCAATCCGG CTGTGGAGAG CGATGCTCCC TCGCAAGCGA TGATCCACAA GGTTGCGCAA    170820
     CGGAGCCAGG AAGAAGACAA AGCCTATCAG ATGGCGATCG CGCAGATGCT GAGCTCCTGG    170880
     GAAGGACGCC CACCCCGTAC CGATATCATT CTACCTCCCG AAGACAAGAT CATCAGTAAA    170940
     AGCGGAGATG AACCGCGTGC GTCACAGGCC GAGCCTGCCT CTGGTCTGGC GGCGCGATCC    171000
     AAAGCCAACC GATCCCCGGC CATCCTTGAT CAGCGGGCAA GGGAAACGGT GCTGATCCCG    171060
     GCTGGCCGCA TGATCTATGC CCATACGGTC ACGGCGGCTG ATAGCGACAG CAACGGCCCC    171120
     ATCATCCTGC AGGCCGATAG CGGTCCCCTG GCCGGAGACC GGATGATTGG CTCTTTTTCC    171180
     AAGAGCAAAA GCACGCGGCT TATCGTCCTG GTCCAGAAGA TTGAACACAA TGGCCAGGAA    171240
     CTCACGGCTG ACGGCCTCGT CGTGGCGCCT GACACGATGG AGACAACGGT CGCCTCCGAT    171300
     GTCGATCAAC ATTACATGGA ACGCGTGATC ATTCCGGGCG CCGCCGCTTT TGTCGAAGGG    171360
     GTCGGCCAGG CGATCGCCAT GAGCAATACG ACCAGTCAGG TCAGCCCCTT GGGCGGGGTC    171420
     ACGGCTTTCA CGAAGCTCAA TTTTCAACAG CAGCTTGGGG TTGGCGCGGG CGCGGTCGCC    171480
     AGTCGCCTGG GAAGCATTCT CACCCAGCAA ATGCCGACCG GCCCAACCGT GCAGCTCGGC    171540
     GCCAATCTTC CCGTCGGCGT CATGTTTATC TCTCCCGTAA AAATGAAAAC TGCCGCGGAC    171600
     CAAGCCTCGT CTTTCGCGCA GTAGGACAAG ACGATTGGAC AGGGGAAATC AGAAGCATTG    171660
     ATTGAGGGAG TATGATGTGA TGACAGCACA AACCATGGCT CTGATCGAGG ATGATGATGA    171720
     CGACGATCAT GGATCGTCTG TCGCCCAGTC AGAAGGGTCT CACGCGCTTG TGGCCGGCCG    171780
     TTCGGCCTCT TTCTGGCGCA AGCCCTTGCC TCAATGGCTC AGCGGCAAGA AGGCACGACG    171840
     AGAGGGTTCC GGTCAGGCTG ACACACAGGC CGAGCTCCAA GCACCAGAGA CAGCCCCTGA    171900
     AACGGAGGCC GACGCCCCTA TTGGCTTGCC AGGAGAAGGC CAGGCGATCC TTGAGCCCCC    171960
     ACAGGGAGCC GAGGGCGCTC AAACGCCAGG GAAGTCCCAA TGGAAGCCTT CCAAGCCGCT    172020
     CCTGATAGGA GTGTCGCTCA CGGCTTTGCT GGTAGCCGCG AACATCGGTA TCATGTCTTA    172080
     CCCGCAGTCG TCTCCGTCGC TCCCTGTGGC CGGCCCGGTG GCGGAGCGCC AGGCCGGGCC    172140
     TTTGGCGCCT TTGGCGAAAC TTGCGACTGT CCAACCGCAT CAGCCTGCGG AAGATCCCAC    172200
     GGCGGTCAGC GTTCCCGCCC AAAGTCCGAT GGACGAGCTT CTCTCATTTC ATCCGGTGGA    172260
     CCCCATCACG GGAAAGGCAA GCGGAGGAGA AGAGCATAAA GCGGCTCAGC CGATCTTGGC    172320
     CAAACTGGAA GTCGCGCCGC AACAGAGCAA AACCACAGCT TTTCCGATGG ATTACTTCGG    172380
     AACGCAGGCT TTCGCCTCTC TGAATGGCCA GGATCAGACG TCCAGCAAAC CGGCTGAGAC    172440
     GGTCACTGAG CCTATGATGC AGGCAGCTAC GCAGGCCAAG ATCGAGGAGA CCAAGTCCAG    172500
     CGATATCCCG CGTGTAGACG TCAAGGAGGC CAAACCCTCG TCACAAGGGA CCGTGCCACA    172560
     AACTCTTGTG ACGTCAGCCG TCTCCACCGA TCCGCATGAC GCGGAAAATC GTGCCCTGGC    172620
     GATGGTCACC GAATATGCGA CGATCGTCGG CGAGCTCCGG ACTGAGGTCG CGGAGATGAA    172680
     ACAGAAACTC GCCCATGCCA GCCAAAGCAA CGAGGCGAGG ATTTCCGATC TCGAACGGCG    172740
     CGTGACCTTT ACCGAAGCAC GGCGAGCGCT CGATGCGGCG CATGATGCAC CGCGCCTGGT    172800
     CGCCATGCCG GTGCCGCCCG GAGCTCAAAA AGCCGGAGGC AAACCCTCTG CGAATACCGG    172860
     CATGATCAAA GCCTCGTTCG ACCCTTCCTC CCGCGAGCCC ACTCCCTCGA TCGAGGGCCG    172920
     GCCGCGCTAT CGGGTTCAGG CGGCCTCCCC CAATCTAGCC ATGTTGACGG CTCTGGACCG    172980
     CAGCGGCGAG GCGGATGGGC AGATCCAGGT GGCGATCGGC GACGTGATCC CCAATTACGG    173040
     CCGGGTCAAG CAGATCGCGC AAAAGGGGAC GAGCTGGGTG ATCGAGACGG ATCAGGGCAC    173100
     GATCGAATAG GAGCGGGGGA TGCAGGGGCT CGTCAATTTC GCGGCGGCCG TCGGACAAGG    173160
     GCTGGCTGTC TTTTTGCCAA CCTTTTGTTA TCTGACGGCC ATTGGTCTGT TTCTTTTTGC    173220
     AGGATGGGGG TTCTGGCGCC AGGCACAACC GGATAATCCC TATCGGGGCA AACCGTGGAT    173280
     CCCGATATTC TCTCTCGTGC TCTGCGGTGT CTTTGCCTCC TTTGATCGCA TTTTGACGAT    173340
     GGCGAATGTG TCGATGGGCA CGAACCTCCA GGTCTCACTA TCCAATAATC TGACCTCGTA    173400
     TGCTCCCCCG GTGGATGGGA ATGTACTCGG GACGACTCCA GGGACGACGT TGTTGAATGT    173460
     CGTCACCTTG TTCCAGAGCT TTTTTCAGGC GTTCGGAGCC ATGGCCTGTT TCTTTGCGGT    173520
     GTTGACATGG TGGTCGATCG TGACGGGTCG CACGAACCGG AGCACGGTCG GTACGGGAGT    173580
     TCAATTCGTC TTTGGAGTTC TGCTCATCAA TGTCATGACC GTTGCGACGT GGCTTGTGAC    173640
     TATTTTCCAG ACTTGATGAA AGTAAGAGCT TTACCGATGA ACGGTTTATA TATTGGCGCC    173700
     TTGTTCTTCC TTGGTTTAAC TGCATACTCA CTGTTCAAAG GGTTTGTGCG CGGACCAAAA    173760
     CGTTATTACA TACTAGCGGG TTCTATTTTT TTGTTTGTAT CTAGCTTCTA TGTAGCGGTT    173820
     GATTTGTTGC ATTTGTAATG CTCGTGCCTG GCATTGTGGC AAAACGCCTA TCAGGATAGG    173880
     TTTTCCGAAG TTTCGTAGCT CCTTCCTCCC GCCTGTCCCT TGATCCCGCT CTCATGGCGG    173940
     GATTTTTTTG TTTATCTGAA ATTATTCTTT TGAGGCCGTA TATGTTTTCT CATGACATCC    174000
     TCTGACACTG GCTATCGAAG GAAACAATCC TTCGATTTTG TTCAGGAGTG TGATCATGCA    174060
     ATTGCTTGGT GTGAAGAAGA AGGCCGCCGA CAAGACGGAG GCCGATACGG AAAAGAAATC    174120
     CCTGGTCGAG CGCATCCTTG GTGTTGGCGC GGTGGGTGTT TCCCTCGGCG CTTTGATGAC    174180
     CGGTCAGGCC TTTGCTCAGG GCGCGAGTCC AGCTGGTGGC ATCGGCGCAC AGTTGAACTC    174240
     GTTGACGTCG GAAGCGATCA ATTCCGGTGG CCAGGCGGGC CAGATGGCGA TGTATCTCGC    174300
     GGCTCTGCTC TGTTTCGTCG CGGGTGTTTG GGCTCTGTGG CAGGCGCAGC AGCCACAGAA    174360
     CCGTGAAGGG GGCATGCGGG CGGCGGGGAT CGCCGGTATC ATCCTCTGCG GTTTGTTCGC    174420
     GACGGGCGGT ACTTGGATCA ACAAGGCCGC GATGAGTACG GGTGGTAAGA CTGCTACGGT    174480
     GAGCGCTACC CCGCAAACTG TTTCATTCCA GTAAGGCGGG CCAAAACGAT CATGCCTCTT    174540
     CTGCCGCTTG TGCCGAATAT TCTGGAGGGA TCGGCGTTTC TGGTCCCTCC CACGCATGAG    174600
     CGGCAGACCA CACTATTCTC CTGCCAGTTT TGTGGTTTTG ACGCCGCAGG CTGGCAGGTG    174660
     CCATTTCAAG ACCCTGAAAC CGGCAAGGCC GGTTCGTCCT GTGTCCTTTG TTCCTTGGTC    174720
     CTTCGGCTCG ATCGTCCCCG GATCGATGAA GAGCTGGCTT TGATCTGGTT GCCGGAAATG    174780
     TCTCAGGCAG CCGTGAATGC CGTTGCCCGC TCCCTCCACG GACTCTTCTT CGCTCATGGC    174840
     GAGGCGCCGT CACCAGCTTT GAGGCCCCAT GGAGAGACGG CGCGGATGCG GGCGGCTTGG    174900
     TTCTTCTGGC AGAGTTTGCT TCAGCGGCAG GCTATCGCCA AGGAGCGTTT CGGCTCGGAT    174960
     CGGCCCAGCG ATATTGGCCA GGTCCTGGCC TCGGTGGCTC CACTGATTTT CAATCGCCGG    175020
     AGCAAGCTTC TGTCGGGTCT GCGCCTTTTG CCACTCGGTC ATGTTTATCA AGGCGGGCAG    175080
     GACCATTATC CGCGTCTTTT GGCGAGTTAT CTCAAGACGC AAAAACAGGC CGGGCAGGGG    175140
     ATCAGGGGTA CGGTTGAGAC AGTCCCGTCA GCATCCTGAA AGGTCCGCTC ATGAATTTCA    175200
     TTGCTCAATG GCTCGCCTCG CTGAGCCTGA TGCTTAAACA ACCCCTTGGC GCCTATTGCG    175260
     ATGTCGAGAC GGCGCATGGG GATGCGCTCG TCACGCGTTA CGGCGATTAT CTGTCCTTCG    175320
     TGCGGATCGA TGGCTTGCGG CGGATGTGTA CCAAGGCCGA ATATGCCGAC ATGGCCAAGG    175380
     CCATGCGGCT CGATCTTTCG GGCACCTTGG AAGAGCGCGG ACATGCCATC CAAGGCTTTT    175440
     ATATCTCGGA CCCTGATCTT TCGGAGCGCG AGATCAATCG TGTGAACATG ACCGCCTGCC    175500
     GGACGGTGGC GAAGGAAGTC GGTCTCGATC TGGACGACAT TCTGGATGAG CGGATGCGGA    175560
     TCTGGCCCCG CGTGATGCGC TGGGAAGCCG CCTATTACGT GTTGTGGACG AGGCGCGGCA    175620
     TCCTTACCAA GGAAGAGAAG AAAATCCTCA AAGAGGAAAT GGCGGAGCTC GCCAAGGGCT    175680
     GTCCCGCAAT CGGCGAGTCG CAGAAATATT TCCTGCGCAG CGAAGTGACG GCGGCTCATC    175740
     ACGCGGGTTT TGTCGCGCGT GTCGTCAATT CCTTCAAGAG CCTCGACATT CACGCGGAAG    175800
     AACTGACGGC GCATGATGCG CTGAAGGTGG CGAGGGAGAC ACTTTATCGA GAGACCTCTG    175860
     GCTCGCCTTG GAAAGCGATC TTGCCGGGGC AGAAGGTGAT GCCGCGCCTG CCGGAGGATG    175920
     ACGAAAAGCA TCCCACAGCG GAGGGCTTGC TCTGGCCCTC GATCCGCTCG CAAATGCTGA    175980
     CGTTCGATGC GATCACGCAG GGCGGTCAGC AAGTGGCACT TGGCACGAAT ACCTATGCCC    176040
     CGATCGACAT GGTGATGGGA CCTGAGGACC CGCGTCCCTT TCTCGAACTG GCGAGTTATC    176100
     TGGGACAGGA TCGTATTCCC TGGCGCGCTT CGTTCCTACT CGAAGCGGCG GGGCGAAACG    176160
     GCATGGCCTT CAAGGAGATC GGTGCAACCT TTCTTGGCAT GTTTCCCCAA AACGGGGACC    176220
     TGCGCCGTGC CTTTGCCGCC TTGCGGCAGG CCAGAGAGGA AGACAATCAT GGGGCCGTCA    176280
     AGTTTCGGGC CTCCTTTGCC ACTTGGGCGC CAGGCGATGA TATCCGCAAG CTGCGCCGCC    176340
     GTGCCTCCAC GTTGTCGCAA CGTCTCGAGG GCTGGGGCAA TTGCAAAACA GGTACGATGG    176400
     CGGGCGATCC GCTCGATGCG GCGATGAGCT CGGTTCCCGG AATGGCGGTC GCCTCGACCG    176460
     CGCCGCCGTC TCTCGCCCTA TTGGGTGATG CTTTGCTGAT GCAGCCCTGG AGCCGCACGG    176520
     CATCTCCCTG GGAGGCTGGC TCGGTCCTGT TCCAACTGCC GCATGGGGGC CTCTGGCCCT    176580
     ATGATCCTGC TGGGGGCTCG AAACGCCCAT CTGTCGTCGA TATCTTTGTG GCCCCGCCCC    176640
     GTTCGGGCAA ATCGGTGCTG GCCAATACGA TCAATCTCGG CCTGTGCCTC AGTTCCGCGG    176700
     TGCTCGGCTC GCGCGGGGCC AAACTGCCGA TGATCGGCAA AGTCGATATC GGGCCTTCGG    176760
     CGCAAGGCTT CGTGCGGCTC ATTCAGGAAG CTCTGGGACC CGCGCGCCGG CATGAGGCAA    176820
     TCTATACCCT GATGCAGCTC ACCCCAGGCT ATGAATTCAA TGTTTTTGAC TTACAGCTCG    176880
     GATGTGAATA CCCGCTCACC TTGGAACGGG CTTTTCTGCA GAACTTCCTC GTTCTCTTGA    176940
     CGTTACCGCC TGATCGTAAC GAGCCCCATG AGGGCGTGCC GCAATTGATC AATGTGCTGA    177000
     TCGACGAGGT TTACCGCCTG CATACGGACA TTCAAGGCGG TTATCCGAAG ATCTATCAGG    177060
     CCGGGGTGGA AAAGGAGGTG GACAAGGCAA TCGCCAAGCA TGGGATCGTG CTGCATGAGC    177120
     ATGAGCCGCA TTGGCGTGAT GTCGTGAACG AATTGTTCAA GTGTGGCGAA TATCGGCTGG    177180
     CGGAAGTCGC ACAGCGTCAT GCCGTGCCGG TCCTTGAGGA TCTGATCAGA GCGGTGCAAT    177240
     CCGAGATTGT AAAGGATCAG TTCAACGCCC TGCAACTGCA CACCACGGCC GAGAAGGTGA    177300
     CGGAACTGTT CTCGCGTTAT CTGCAGGATG CGATCCGCAT GTATCCGATC CTGAACAAGC    177360
     CTACGAAACT GGATTTCGGG CCAGCCCGCA TCATCGTTCT CGATTTGGAG GAAGTGGCTC    177420
     CGCAAGGTTC GGCAGTGGCC GATCGGCAGA CGTCAATCAT GTATCTTCTG GCGCGTTATA    177480
     TCTTGGCACG GAATTTCTTT CTCAAACCAG AGTATCTGGT GCAAGTGCCG AATGCCTATC    177540
     GGGATTACCA TCACGATCGT TTCCGCGAGG CCTATGAAAG CATCAAACGC CTGGACTATG    177600
     ATGAATGGCA CCGTACTTCT GGCAGCCCAC AGATTCGTGC TCAAGCGGCT CGCGATATTC    177660
     GCGAAGGGGG CAAGCACAAT GTCCAGTTGG CCTTTACCTC GCAGCAAATC AAGGACATGG    177720
     GCGATGACAT CATCAGCCAA TCGACAGGCC GTTGGATTTT GCGGGCGGGT GACGAGGAAG    177780
     AGGCCAAAAT CATCATCGAG CGTTTCCATT TGACGGAAGC CTCGGCACGA GTCCTACGCT    177840
     CCAGTCTCAA TGGTCCTGGC CCGAATGGCG CTCCTGTTCT GACGATCCTA GAGGCCGGGG    177900
     CTTACCGCTA TGAGCAATTG CTCGTGAACC GTCTGGGGCC GGTCGAACTT TGGGCCTTTT    177960
     CGACAACGCC TGGCGATACG AGCCTGCGCA ACAGACTTTA TTCGCGGCTC GGCTTCAGCG    178020
     AGGCCTTGCG CCGCTTGTCG CAAATCTTTC CGCATGGCTC CGCGCTGAAG GAGATCGAGC    178080
     GCCGCAAGGA GGAACGGTTA CGCAATGGCG AGCGCGATGA GAGCGTGCAG GCGGGTGTGG    178140
     TTGACGAACT CGTGGAGGAA TTGATGGATG GTCTCGGCAT CGGCCTCAAA CTGCGCGACC    178200
     AGGTCGAAGC CCAGAACGAA GAAAAAAGCC TGGCGTCCGT AGCCTGACGC CGAGGCCCTT    178260
     TCTTTTTCAC ACGATCATGG GTTGTAATGC CTCTCGAGCC TTGCAGGCTC CGTCTATGCC    178320
     TGGCCGCACT TCCTTCCTCG TCCGATATCA GCCGGGAGGG CAAACAAGGC CCCGATCGAG    178380
     ATGCGCAAAA CACGGAAAGT ATGCTTTTCG TGGTCAGGTT AAGTCATAGC TGGAAATCGG    178440
     GGCAAGCTGA GAGGGTCTGG GTGGTGAAAA GCCATTCAGA CCCGTTTTTT AGGGGCAGTC    178500
     GGAGGAAAGG ATGGCGCCAC AAACTTTGAT CTTCATCTTG GAAGGATTGG CGATCGGCCT    178560
     TGCCTGCCTG TTCCTGCTCT CGAAATTCGG AAAGCCGGCT TTTCCCTATC AGGCGAAGAC    178620
     TTTGCTGACA GCTTGGGAAA TCAATGCCTT GAAGGAACTT GTTCGCACTT TGCCGCCGAG    178680
     CCTGCACCCC TGTCCCCAGG TGAGACTGGC GGATCTCGTG ATGATCAAAC AGGGGCTTTC    178740
     AGGGCGGCAT CGGTTTACCG CGCTCAACCG GGTCGCCGCT AAAAGCGTGG ATTTCGTCAT    178800
     TCTGGAACAC CACACGGGGC GGATTGTGTT GGTCATCGAG CTCGATGACA AGACCCATGC    178860
     GCGGCGCGAT CGGCGTGTTC GCGATCGCTT TGTCGATGAT GTCCTCAATC GCTGCGCCAT    178920
     TCCTCTGCTT CGGGTGAAGC CGGGAGAATC GATTGCCTCG CGTGTGCTCT CGCACGGCGC    178980
     ACTTTTACCT TGAGATCAGA AACCCGGATG TTCTGGAGGA AACGATGTCC TTGCCGAAAG    179040
     TGCTCTGTAT TGCCGCCCTG CCTGTCGCCG CTCTAGGTTT TATCGGCTTC AAAGTGAATG    179100
     AGGCTTGGAC GAAACAAGAG ATTACGGAAC AGGTCCGGTC CTTTTATGAT CATACTTGCG    179160
     GTTTACTTGC GCCGATTACG CCGCAGGAAA ATGAGACGAT ATCAGTTGAA CAATACGATG    179220
     CCCTGGTTGA CGCCGGCATG ATGACACGGA GCCCGGAGGC CGTGTATGGC CTGACGGCGC    179280
     AAGGGCAGGC GGCGTTTCAA TTGAGGGATA AATGGCCGAT GGGCAAGGCT GGGCTCTGCG    179340
     CTTATCATTT CGAGGATGCG ACTGTAGAAG ACGTCTCCCT CACAGAAATC ATATCCAATC    179400
     ATTTTCTGCG GCATGTGACC TTTAAGTTCC ACACACGCTA CGAGGATTGG GCCAAAACAC    179460
     CATCCGTTCA AAAGGCCTAT AGAAGCGAAT TGGGTTTGAG CCGTGAAAGC CTGCTGACAG    179520
     CCCCGATGGT TTTGACCAAA TCCGGTTGGA TCTTTGTGGA GCCGTTGATT TAGACGTCTC    179580
     CTTCCAACAT TTTACAGAGA CTCTTTCAGG TCACGCGCGA TCTTAAAGCC GACTGTTTTG    179640
     CTGGCCTTGA TTTTCATGGC TTCCCCGGTC GCCGGATTGC GTCCCTGACG CGAGGCGCGT    179700
     TTCTTCACTT GAAAGATGCC GAGGCCGCTG ATCCTGATTT TGGAGCCTTT CTTCAGGTGT    179760
     TTGCCGACCA GTTCGACCAT ATCGTCGAAG AGGGATTCGA CGGTTTTTTT CGGCAAATCA    179820
     TGAAGGATGG CGAGATCAGC GCCGATTTGC TTCAAGGTAA TCGTCGGGAT TTCCGTGGTC    179880
     TTGGATGAGC TCGCTGCTTT CTTTTCGGTG GCTGGCTTGG ATTTCGATAT GGCCATGATC    179940
     GTACCTCGTT GGGTTTGAGT AAATTTCAGC TCCATTCCGT AACGTCTTTC TGCCGCATCG    180000
     CGGAATCCAC AGAAGGACGT CATCCACCAA AAATTGGTCT TGGCCCTTGT AAATCAGCCC    180060
     AAGGTTTTCG CGTGAGCCGC CCCTAGCCTG ATGGGGATCG ATAATCAGGA AGTTTTGGGA    180120
     TGAATAAACC GTTTTTTGCT TCTAAACAGG TACAATCACT ACTTGATGAA GTAAATAATG    180180
     CACTGGGTCA CCCTGTGCGC GCAGATCATA AGCGTCTAAC TGCGAACATA CCATTTGGTG    180240
     CTCTTCATTG GACGCGGGCC GATTTATTTC CTGACAAAGA ATGGGGTAAA GCCCACTTTA    180300
     CTATAGAAAC AGGCTGTGGA ATTGCCTGTA TATTCGTAGA TATTGTGCAG TCTGAATGTA    180360
     CACTTCCTAT AAAGTGTCAA ACCGAAAGCG ATTGGGATGG GGAATATCCT ACTACAAAGT    180420
     CCGAAATTGA GATCTCTCTG ACGTTGAATG ACATAAAGTG TCTTGTCGCT ATTTTACTTT    180480
     ACAGTTATGC GCCTCTCTCC GTGAGCATTA CAACAAGCGA ATGAAGGCTA TGGATGTGTA    180540
     TATCGAGCCG GTGCTTTTCT ATTGTAAGTA CCGCTTTTCC AAATACAAAT ATATCAACAG    180600
     GGTAACGATG CCGCATTTGC ATTCCAATGC CCCGCTCAAG TACATCGAGA ATTGCTTTTG    180660
     CTCCACGTAA TTTTGATATT CTTTCGCGTT TGACGAAAGT AAACACCTCA CAATTTGATT    180720
     GGTCACTTTG TACAGATTTG TTCCAGAATT TGAAACTGTA ACCAGTACGG TATTCCATAA    180780
     TATTCGCAGC GCCATAGTAA ATTAGAGGCT GTTCGTTTTC GCGGCAATAC ATGGAAGAAC    180840
     GAAACCACGA TCTATATGAT TTTTCTCCAT ACGGCGGAAT CGAGAGAGAT ACGGCTTTTT    180900
     GTTCCTCGGG TGTCATAAAT TTAAAACAGT GAACAACCTC ATGGAGTCGA CTTGTGGAAT    180960
     TAAGCGCGTT TTTAAGATAA CCCTTAAGTT CGTTGATGCG TTCTCGGCGA TCCGAAATGA    181020
     GTTTAATCCG TTCAAGGAAG CCGGCGTCGA TGTCCATGGT GAACTTTGTA TCGCACTCAT    181080
     CGTTAGAGAG CGGATTAAAG ACATTAATGA TCTCGCTCTT CTTAAGGTGC GATAGATATG    181140
     GCTTGTTTCC TATTTCCCTT TCCAATTCAT CAAGCGCTTG AGAAATTTCC GCCCATGGAC    181200
     ATGTAGGTAA GTGAGTCGTC CCTTTTTTTA AGCGGAAATG TGAGCGCTGA ACAAAATCAT    181260
     CTTCTTGTGG ATTTTTGTCA TAATTAATGC CGAGAACTTC TGGATTGTGT GCCTGACGGC    181320
     ATTCGTTATC CGGGCAACGA AAGTCAAGCC TTTTGCGAGG GTGCTTTGTT TGGGAGAAGA    181380
     ATATTTCACG CGCCTCAACT ATATCGATAA TACGATTAAC ATCTGTGCAA AATGCCTTGG    181440
     GTATACTCAT ATTGATACCT ACCAACTGGC GATGCTCGTC ATTCCTTCGT CTACATCACT    181500
     ACCTGCCTTT ATTGAGCAGA CCGTTCCTTT TTAGGTACTT AGAGAATTAA GAGGAACAGC    181560
     GTTGGCTCGA TCACACGCGT GTAGATCTCC GCAATAAATC GCAGAGGAAG ACGTAGAGTC    181620
     GGACAAGCTC CTATCCTGAC TCATTTTGAG CCAAGGATGT GGACGAATCC ATGTTGGCGG    181680
     ATAGAGAACT TCAAAAAATA ATTTCGTCTC ATGCATATCC AGGAGGTTTT CTCGTG        181736
//

If you have problems or comments...

PBIL Back to PBIL home page