(data stored in ACNUC16935 zone)

EMBL: BN001307.CSND

BN001307.CSND        Location/Qualifiers
FT   CDS_pept        1051281..1052507
FT                   /gene="csnD"
FT                   /locus_tag="ANIA_01539"
FT                   /old_locus_tag="AN1539.4"
FT                   /product="COP9 signalosome complex subunit 4 (Signalosome
FT                   subunit 4) [Source:UniProtKB/Swiss-Prot;Acc:Q9C467]"
FT                   /note="transcript_id=CADANIAT00008166"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008166"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008166"
FT                   /db_xref="GOA:Q9C467"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037754"
FT                   /db_xref="InterPro:IPR040134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C467"
FT                   /protein_id="CBF85069.1"
FT                   /translation="MPSQKIISALAEIESSASPQNKLQLYNDLLSETVSASPEPQLADD
FT                   LIYYLDSVLSEDLSIVAARPILDSFIYTLRKLSSETQIKVAQHAVNLLQSRSASVEEQD
FT                   AQIREILADAYEAEEEYIAAARALQGIHIDSSQRLVSDSAKVKLWIRIVRLYLEEDDTT
FT                   SAEAFLNRIKNLPSKIEDHELKLHFRLSQARIQDARRRFLDASQEYFAVSLAAGVDESD
FT                   RLQALAAAIRCAVLAPAGPQRSRTLATLYKDDRATSVEEFGILEKMFLDRLLTPEEVSA
FT                   FAQRLAPHQLAQTADGTTVLDKAVVEHNLVAASKLYENIKTDALGAILGLQASGDLTAG
FT                   EKAEAYAARMVEQGRLSGSIDQIDGIIYFESNTTATGRHIRQWDAGVQGLSEGVERVAT
FT                   NIAEGHLVR"
     atgccatccc aaaagataat ctccgctctt gcggagattg aatcatcagc gagtccccag        60
     aacaaactac aactttacaa cgaccttctc tccgaaaccg tgtcggcatc tcccgaaccc       120
     cagcttgccg acgacctcat ctactacctt gactcagtcc taagcgaaga cctcagcatc       180
     gtcgccgccc gccctatcct cgactccttc atctatactc tacgaaaact gtcctccgag       240
     acgcaaatca aagtagccca acatgctgtg aatctcctcc agtcccgatc cgcatccgtc       300
     gaggagcaag acgcccaaat ccgcgagatc ctagcagacg catacgaagc agaggaggag       360
     tacatcgcag ctgcaagagc gctccagggg attcacattg atagttcaca gcgactagtc       420
     tctgactccg ccaaagtgaa actttggatt cggatcgtgc ggctatacct tgaggaagac       480
     gacacaacta gtgccgaggc attcctcaac agaataaaaa acctgccgag caagatcgaa       540
     gaccacgagc tgaaactgca cttccggctt tcccaagctc ggattcaaga tgcccgcaga       600
     cgttttctgg acgccagtca ggaatacttc gctgttagcc tcgccgctgg cgtagatgag       660
     agtgacagac tccaagccct tgcggccgct atccgctgcg ctgtcctcgc accggccggt       720
     ccacaacgct cccgcactct agcaacactg tacaaagatg accgcgcgac ctccgttgaa       780
     gaattcggca tcctggagaa aatgttcctc gaccgccttc tcactccaga agaggtatct       840
     gcgttcgcgc agcgcctagc cccgcaccag ctcgcacaaa ccgcagacgg aacaacagta       900
     cttgataaag ctgttgttga gcacaatctc gtggccgcga gcaagctcta cgagaacata       960
     aagaccgacg cgctaggcgc tattctgggt ctgcaagcta gtggggatct gacggctggt      1020
     gagaaggccg aagcgtatgc agccagaatg gtagaacaag ggcggctgag cgggagtatt      1080
     gaccagattg atggtataat ctacttcgag tcaaatacga ctgctacggg gagacatatt      1140
     cggcagtggg atgctggtgt acaaggtctt tcggaggggg tagagcgagt cgcgactaac      1200
     attgccgagg gccatctggt acgttga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page