(data stored in ACNUC16935 zone)

EMBL: BN001307.FPHA

BN001307.FPHA        Location/Qualifiers
FT   CDS_pept        complement(join(141411..141704,141761..145309))
FT                   /gene="fphA"
FT                   /locus_tag="ANIA_09008"
FT                   /old_locus_tag="AN9008.4"
FT                   /product="PhytochromePutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5K039]"
FT                   /note="transcript_id=CADANIAT00007846"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007846"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007846"
FT                   /db_xref="GOA:G5EB62"
FT                   /db_xref="InterPro:IPR001294"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR013654"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB62"
FT                   /protein_id="CBF84471.1"
FT                   /translation="MSELPSRSISPRDPSPGETPGRDPSTPSTDAGVGYSASQDAPSFG
FT                   AYDRVYPIRSLVSLEPPATSEPSSNKSKSPLSPTSGARQFSIIDGHTWTRLRSDSRANS
FT                   TDYSGGTGLSPESSEAPSSQRMSDSSSARPPSNTTGLRRGDDHTTFTPSSEDSHPQVQE
FT                   PYELMTTRFRHVVTDDGHAVITGRTVDSFKACEDEPIHIPGAIQSFGALVAVREEPGEQ
FT                   MVVRIVSENSQDILGYSPNDLFSLPTLCDIFPEDQADNFLDHVDFVKEEGYDPSVDGPE
FT                   VFILTVNQPNGSTIRVWCAIHTNPALNGLVICEFELEDDHVNPLTSSGHISPAVPTNTL
FT                   DVVPTIEQMAGSTITINQPLRVLRRARRRKGEAAAMEVFSIVSQIQEQLARADNMEALL
FT                   DTTSGIVKELTGFHRILVYQFDSEFNGKVVSELVDPTMSIDLFKGLHFPAADIPKQARD
FT                   LYRINKVRLLYDRDHVTARLVCRALEDLETPLDMTHAYLRAMSPIHIKYLANMQIRSSM
FT                   SISINSMNDLWGLISCHSYGPRGMRVSFPIRKMCRLIGDTVSRNIERLSYASRLQARKL
FT                   INTVPTDANPSGYIVASSDDLLRLVDADYGALCIRGEVKILAKSPQSQEMLALLEYLKV
FT                   RKYNSVLTSNHIVKDFQDLNYPPGFKDISGLLYVPLSTDGLDFIVFFRRGQLTEVKWGG
FT                   NPNEAKFTEGHLEPRKSFQTWRETVLDRCRDWTESEVDTAAVLCLVYGKFIKVWRQQEA
FT                   ALESSSLTKLLLANSAHEVRTPLNAIVNYLEIALEGALDGETRDHLSKSYSASKSLIYV
FT                   INDLLDLTNVEKGQSLIKDEPFDLPTTFSEATAMFESEAKRKGLNYKVLSQPGIPETVI
FT                   GDQRRVRQSISNLISNAVQNTSSGGVTVEVWHAPGEGDTDKATVKIAVLDTGRGISSST
FT                   LELLFRELEQVSGEDDSHYYGGSEEGEESAPEAKASKDKAVLGLGLALVARIVRNMHGQ
FT                   LTVRSEEGKGSRFQISLQFPIPEGSDTKSPTAEHRPVATGDSAAPFSTGDDVILVDSTT
FT                   GSKRNSQDSLTRPDVPRKSEPEDTAPADGAGEQASGESEAQTRPKKTGESTASTSHEQS
FT                   ETARSRPSGPSSGPSAPERRPLRVLVAEDDPINAKIIEKRLEKLGHTVQRTVNGEECAN
FT                   AYSAESTQWDVVLMDIQMPILDGIESTKRIRQHESQSEVANLHIPIFAVSASLLEKDVQ
FT                   MYMDIGFDGWIMKPINFVRLNTLLAGIHEERARNGAVYQPGQWEKGGWFTPYTHS"
     atgtccgagc tcccctctcg ttccatctcc ccgagggatc cctcccccgg ggaaacacct        60
     ggccgcgatc cctcaacacc atcaacagac gcgggcgtcg gttactctgc ctcccaggac       120
     gcaccatcct tcggtgccta tgaccgagtc tatccgattc gatcgctagt ttcgctcgaa       180
     ccccccgcga cctctgaacc atcttcgaac aaatcgaaga gtccgctctc tccgaccagc       240
     ggcgctcgtc agttttcgat catcgacggc catacatgga cccgtctgcg gtcggatagc       300
     agggcaaact cgacggacta cagcgggggg acggggttgt caccggagag ttcagaggcg       360
     ccatcttcgc agcggatgtc agactcatcg tccgcaaggc cgccgtctaa cactacaggg       420
     ctgcggaggg gtgatgacca cacaaccttc actccctcct cggaggattc gcaccctcag       480
     gtgcaggaac cgtacgagct catgaccact cgatttcgac atgtggtgac cgacgacggt       540
     catgccgtaa tcactgggag gaccgttgac tctttcaaag cctgcgaaga cgagccgatt       600
     catatacccg gcgccattca aagtttcggt gctctggtag cagtacggga agagccgggc       660
     gagcagatgg tggttcgcat tgtcagcgag aattctcagg acatcctagg ctactctcca       720
     aacgatctct tttccctacc gaccttatgc gatatcttcc cagaagatca ggccgataat       780
     tttcttgacc acgtcgactt cgtgaaggag gaaggttatg atccctcggt ggacggcccg       840
     gaggttttta tactcactgt aaatcagcca aatggcagta cgatccgtgt ctggtgcgcc       900
     atacacacta atcctgcact taacggcctg gtcatttgcg agtttgagtt ggaggacgat       960
     catgtcaatc ccctgacaag ctcgggccat atttcaccgg ccgttcccac gaacaccctc      1020
     gatgtggttc cgacaattga gcagatggcg gggagtacga tcactataaa tcagccactc      1080
     cgtgtcctgc gtcgcgctcg tcgccggaaa ggtgaagcag ccgcaatgga ggtcttcagc      1140
     atcgtcagtc agattcaaga gcagctggct cgtgcggaca acatggaggc gctgttggat      1200
     acaacctctg ggatagtgaa ggagctcact ggtttccacc gcatcctggt ataccaattc      1260
     gactcggaat tcaacggcaa ggttgtttcg gaattggtcg atccgacgat gagcatagat      1320
     ctgtttaagg gcctgcattt cccggccgcc gacattccta aacaagcgcg agatctgtat      1380
     cgaataaaca aggtccgtct actttacgac cgggaccatg tcacggcacg gctggtctgt      1440
     cgagctcttg aggacctcga aacacctttg gacatgacgc acgcctatct ccgtgccatg      1500
     tcgcctatcc acatcaaata ccttgctaac atgcaaattc gatcatcgat gtctatcagt      1560
     attaacagta tgaacgatct ttggggcctt atttcctgcc attcgtatgg acccagagga      1620
     atgcgagtgt catttcccat tcggaagatg tgtcgtctga tcggtgacac cgtttctcga      1680
     aatatcgaac gcttatctta cgcttctcgc ctgcaggctc gcaagcttat caacacagta      1740
     ccaaccgacg caaacccctc cggatacatt gttgcctcat ctgacgattt gcttcgtctg      1800
     gtggatgccg actacggtgc gctgtgcatc cgcggcgagg taaaaattct ggcaaagtca      1860
     ccccagtctc aggagatgtt ggccttgcta gagtacctaa aggtccgaaa atacaattcg      1920
     gtactgacgt ccaaccatat cgtcaaagac ttccaggacc tcaattatcc tcccgggttc      1980
     aaggacattt caggtttgct ttatgtgcct ctgtcgaccg acggtttgga cttcattgtt      2040
     ttcttccgtc gcggtcaatt gaccgaagtc aaatggggcg gcaatcctaa cgaggccaag      2100
     ttcaccgagg gccaccttga gccccgaaag agctttcaga catggcggga aaccgtcctg      2160
     gaccggtgcc gcgattggac tgaatctgag gtcgacacag ctgccgtgct ctgcctggtg      2220
     tatggcaagt tcatcaaagt ctggcggcag caggaagccg ctttggagag ctccagcctt      2280
     accaaattgc tcctggcaaa ctctgcgcac gaagtacgca cacctctgaa tgccattgtc      2340
     aactatctag aaatcgcgct tgaaggtgcg ctggacggcg agacaaggga tcacttgagc      2400
     aagtcctact ccgcatccaa gtccctgatc tatgttatca acgaccttct cgaccttacc      2460
     aacgtcgaga agggacagag cctcatcaaa gatgagccct ttgatttgcc caccactttc      2520
     agcgaagcaa cggccatgtt tgaaagtgaa gccaaacgca agggcttgaa ctacaaggta      2580
     ttgtcacaac cggggattcc cgagaccgtg attggagatc agcggcgtgt ccggcagtcg      2640
     atcagcaacc tcatctccaa cgcggttcaa aacacctcgt ccggtggagt gactgtcgag      2700
     gtgtggcacg ctcctgggga gggcgatacc gacaaggcga cggtcaagat cgcggtcctt      2760
     gatacaggcc gcggtatctc atcaagcacg cttgagctat tgttccgtga gctggagcag      2820
     gtctcaggag aagacgactc gcattattat ggcgggagcg aagaagggga ggaatccgct      2880
     ccagaggcta aggctagcaa ggataaggct gttttgggcc tgggcctggc gttggtggct      2940
     cgaatcgtgc gcaatatgca cgggcaactc actgtgcggt ctgaagaagg gaagggtagt      3000
     cggttccaga tttcgctaca gttccctatc cccgaaggct cggataccaa gagtccaacc      3060
     gcggaacacc gtcctgttgc cactggggac tctgcggccc cgttctcgac cggggatgat      3120
     gtgatcctcg ttgatagcac tactggttcc aaaagaaata gccaagacag cctaacccgc      3180
     ccagacgtgc ctcgaaaatc tgaaccggag gatacagccc ctgctgatgg cgctggtgaa      3240
     caagcgtcag gtgaaagcga agctcagact cgacccaaaa agaccggaga atcgacagca      3300
     tctacttctc atgagcaatc cgaaacggca cgttcacggc cgtcaggccc cagctctggg      3360
     cctagtgcgc ccgaacggcg gcccctccgg gttctcgtag ctgaggacga cccgatcaac      3420
     gcgaagatta tcgagaaacg actcgaaaaa ctcggccaca ctgttcaacg cacggtgaat      3480
     ggggaggagt gtgcgaatgc atactcggca gagtcgacgc agtgggatgt tgtgttgatg      3540
     gatattcaga tgccgattct cgatggcatt gagtccacta aacggatccg ccagcatgag      3600
     agtcagagtg aagtcgcgaa tcttcacatt cccatttttg ccgtctctgc ttcattgctt      3660
     gaaaaggacg ttcaaatgta catggatata ggcttcgatg ggtggattat gaagcctatt      3720
     aactttgttc ggttgaatac gctcctcgct gggattcacg aggaacgcgc acggaacggc      3780
     gctgtttatc agccgggaca gtgggaaaag gggggatggt tcacaccgta cacgcattcg      3840
     tga                                                                    3843
//

If you have problems or comments...

PBIL Back to PBIL home page