(data stored in ACNUC16935 zone)

EMBL: BN001307.PE10

BN001307.PE10        Location/Qualifiers
FT   CDS_pept        complement(join(34123..34165,34216..35243))
FT                   /locus_tag="ANIA_09051"
FT                   /old_locus_tag="AN9051.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007802"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007802"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007802"
FT                   /db_xref="GOA:Q5ARM9"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM9"
FT                   /protein_id="CBF84388.1"
FT                   /translation="MSIPTRALGRNGPEVSSVGLGLMSIGGIYGAAPSDEDRLALLDRA
FT                   HAIGQWFWDTADVYFDSEDIVGIWRAKNPIKAKDIFLASKFGITMRKDGSQTVDTSPEY
FT                   ARIALKRSLERLQTGTIDLYYAHRVDGKTPIEKTVEAMAQFKKSSRLPLVFSRTNTNYR
FT                   EGKIRFLGLSEVSADTLRRAHAVHPITAVQVEYSPFTLDIEDPRVALLETCRELGVAVV
FT                   AYSPVGRGLLTGRYVTRESITKDFFLSVLPRYSEENFPAIQRLYESIKDVAEKKGVTPT
FT                   QATLAWLLAREPFVIPIPGTRSIKYLVENTASAQIQLTDDENRRITEAANATKLVGARY
FT                   PAGFPENYEFGTTPEL"
     atgtctattc ctaccagagc cctcggtcgc aatggccctg aagtctcctc cgtgggcctt        60
     ggcctcatga gcattggtgg catctacggc gcagctccca gcgacgagga ccggttggca       120
     ctcttggacc gcgcccacgc cattgggcag tggttctggg atacggcaga cgtctatttc       180
     gacagcgaag atatcgtcgg catttggcga gcaaagaacc ctataaaggc aaaagatatc       240
     tttctcgcat ccaagttcgg catcacgatg cgtaaggacg gcagtcaaac tgtcgatacc       300
     tcccccgaat atgccagaat cgcactgaaa aggagtctgg agaggctcca aactggaacc       360
     atcgatctgt actatgctca tcgtgttgac ggcaaaacac ccattgagaa gacggtcgag       420
     gctatggccc agttcaagaa gtcaagtcgt ctgcctctcg tcttttcccg aactaacacg       480
     aattataggg aaggcaagat ccgatttctc ggcctcagtg aggtgtctgc cgacactctt       540
     cgccgtgctc atgctgtcca ccccatcact gccgtccagg tcgagtatag cccatttaca       600
     ttggacatcg aggatccccg tgtcgctctg cttgagacat gtcgtgagct tggcgtagcc       660
     gttgtcgcct acagccccgt tggtcgtgga ctgttgacgg gtagatacgt cacgcgcgag       720
     agcattacca aggacttctt cctcagtgtc ttgcctcgtt actccgaaga aaacttcccc       780
     gccatccaga ggctctacga atccatcaaa gacgttgctg agaagaaagg agtcacaccg       840
     acacaggcaa ccctcgcctg gctgcttgcc cgggagcctt ttgttattcc aattccaggc       900
     acgcggtcga tcaagtactt agtagagaac acggcgagtg cccagataca actcacggat       960
     gacgagaacc ggcgtatcac cgaagccgca aatgcaacca aattagtagg agccagatat      1020
     ccagctgggt ttccagaaaa ctacgaattt ggaaccactc ctgagctgtg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page