(data stored in ACNUC16935 zone)

EMBL: BN001307.PE100

BN001307.PE100       Location/Qualifiers
FT   CDS_pept        join(272267..272303,272444..273468)
FT                   /locus_tag="ANIA_11156"
FT                   /old_locus_tag="AN11156.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007891"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007891"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007891"
FT                   /db_xref="GOA:C8VL88"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8VL88"
FT                   /protein_id="CBF84554.1"
FT                   /translation="MNILPRHAIATREQIFSASSPIPSGLLPQLKLPEGRNNAKNSLPT
FT                   RARHECPHIQVSDWYLPFASSIYCNPFSRAQFIIILLYSTNPPHRTASFRRTLPHSYVF
FT                   DFISGPFPSSPAPGIKAIYPDSPTYTWFREPTPAGLRAAHRYVAEYIQKHGPYDAVMGF
FT                   SQGCSLIASMALYHSYDRLSEQGQNGIRGDLPFKAAIFICGGIPLYALQDMGIPVSEEA
FT                   ETISKITGQLLNTTATKLSTFASNTSLIKRGVGLWDNNVTSNTLVHDPSVRPPRNDLFG
FT                   LDFTSFPSWAKIDIPTVHVYGGKDPRWPAGIQLAEFCADRVEFDHEGGHDIPRGSVVSE
FT                   RIGGMIQDLLRRV"
     atgaacatat tacccaggca tgccatagca acgagggaac aaatattcag tgcctcgtcg        60
     ccgatcccta gtggtcttct cccgcaacta aagttaccgg aggggaggaa caatgccaaa       120
     aattctctgc ctacacgggc acggcacgag tgcccacata ttcaagtctc agactggtac       180
     ctccctttcg cctcttccat ctactgcaac ccctttagtc gagcacagtt cataataatt       240
     ctcctataca gcactaatcc tcctcatcgc acagcatcct tccggagaac cctcccccac       300
     tcgtacgttt tcgacttcat ctccggcccc ttcccctcct ctccggcgcc agggattaaa       360
     gccatttacc ccgactcgcc aacctacacc tggttccggg aaccaacgcc tgctggttta       420
     cgcgctgcac acagatatgt ggctgaatat atccagaagc atgggccgta cgatgcagtc       480
     atggggttct cgcagggatg ttcattgatc gcatcaatgg cattgtatca ctcttatgac       540
     agattgagcg agcaggggca aaatggtata cgcggagacc tgccatttaa agcagcgatt       600
     ttcatttgcg gcggtatccc cctttacgcg cttcaagata tgggcatacc tgtttccgaa       660
     gaggcagaga ctataagcaa aatcacaggc caacttctca acaccaccgc aacgaaactc       720
     tcgacctttg catccaacac atcgcttata aagcgtggcg tgggactctg ggataacaac       780
     gttacctcca acactctcgt tcacgatcca tctgtccggc ccccccgtaa tgacctcttc       840
     gggcttgatt tcacatcttt cccttcctgg gcaaaaatag atatcccgac agtgcatgtt       900
     tacggcggta aggatccacg gtggccagca gggatccagt tagcggagtt ttgtgctgac       960
     agggtggagt ttgatcatga aggcgggcat gatattccgc gggggtcagt ggtctcagag      1020
     agaattggag gtatgattca ggatctattg agaagggtct ag                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page