(data stored in ACNUC16935 zone)

EMBL: BN001307.PE101

BN001307.PE101       Location/Qualifiers
FT   CDS_pept        join(273684..273794,273854..274495)
FT                   /locus_tag="ANIA_11157"
FT                   /old_locus_tag="AN11157.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007892"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007892"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007892"
FT                   /db_xref="GOA:C8VL89"
FT                   /db_xref="UniProtKB/TrEMBL:C8VL89"
FT                   /protein_id="CBF84555.1"
FT                   /translation="MPQNAKNYTDPELREQVKNEVQQGDKGGKPGQWSARKAQMTASEY
FT                   KARGGDYTTSKDEKKSEQKHLDKWTNEEWQTKEGSGTAKQDDGTRKRYLPKKAWEELDE
FT                   REKKATEQKKLEGSKAGKQFVANTGEAKRKRGEVSREGEKKGSRNGGKDKKGGQVDRKK
FT                   EKEGKMKQEPEENGENGENEEEEVENTENDEDYERDGEDLDGENEESGDNSGSEDEDEE
FT                   QNQQADEKETETDTPEGEQPEKKRQKQD"
     atgccccaga acgcaaaaaa ttacacagac cctgagctcc gcgaacaggt caagaatgaa        60
     gtccagcaag gagacaaagg cgggaaacca ggtcaatggt ctgcgcgaaa ggcccaaatg       120
     accgcctctg aatacaaagc acgcggcggg gactacacga cctccaaaga cgagaagaag       180
     tctgagcaga aacatctcga taaatggacc aacgaagaat ggcaaacgaa agagggctct       240
     ggcacagcga agcaggatga cgggacgcgg aagaggtatt tgccgaagaa ggcgtgggaa       300
     gagctagatg aaagggagaa aaaggcgacg gaacagaaaa agctggaagg gtcaaaggca       360
     ggaaagcagt ttgtagcgaa tactggagag gcgaagagga agaggggaga ggtaagcagg       420
     gaaggagaga agaaagggag caggaacggg ggtaaggata agaaaggggg tcaggtagat       480
     aggaagaaag agaaagaagg gaagatgaag caggagccgg aggagaatgg ggagaatggg       540
     gagaatgagg aagaagaggt tgagaatacg gagaacgacg aagattatga gagagatggg       600
     gaagacttag atggcgagaa tgaagagagc ggagacaaca gcggtagtga agacgaggac       660
     gaggaacaga atcagcaggc cgatgaaaag gagactgaga cggatactcc agaaggcgag       720
     caaccagaga aaaagagaca gaagcaggac tag                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page