(data stored in ACNUC16935 zone)

EMBL: BN001307.PE102

BN001307.PE102       Location/Qualifiers
FT   CDS_pept        complement(join(276386..276429,276816..277246,
FT                   277298..277748,277813..277917,277973..278130,
FT                   278195..278418))
FT                   /locus_tag="ANIA_08964"
FT                   /old_locus_tag="AN8964.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007893"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007893"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007893"
FT                   /db_xref="GOA:Q5ARW6"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW6"
FT                   /protein_id="CBF84557.1"
FT                   /translation="MDTREKALANLHAAGLSDILYLPSSDVYSARVESYWSLTAQLKPW
FT                   AIVRPRNTEEVSKAVKAIVATPDVKFAIRSGGHMQWPGANNIVNGITIDLGLMNSTTYD
FT                   PETGIASIQPGGTWAKSYQELEKQGRMVAGGREGKVGIGGLLTGGGKTFYTCRNGFACD
FT                   QVVNYELVLADGSISNANSTTNPDLFRALKGGGNNFGVVTRFDMTTFSAVDVWDCTITY
FT                   PKKATLQLSEAIVDLTKNLAAYPDDHILAMWTYLPKTEEHFVMVNMMNLEGVKEARTLE
FT                   KFLGIPEQMNRVDTTVSVATKLTSFVVPSGKYDTWYTTTFKADPQIILKSASVFESLVS
FT                   ALKNQVPYSNFYTQIVLQPLPVSFGAHSTARGGNMMGLDQMKVDCVLLVWAVEVDTPEL
FT                   NANVAGPTLKSAIEKIETYARSVKGDVGFRYLNYCDKEQDALGSYGEENVRHMKEVAVF
FT                   SEKVAEDVVRLS"
     atggatacca gagagaaagc ccttgcaaac ctccatgcgg cgggcctaag cgatatcctc        60
     taccttccca gcagcgatgt atacagcgcc cgtgtcgagt catactggtc actaacggcg       120
     caattaaaac catgggcaat cgtccgaccg cgaaacacag aagaggtctc caaggctgtc       180
     aaagctatag ttgcgacgcc agatgtgaag tttgccatcc gaagtggcgg acacatgcaa       240
     tggcccggcg caaacaatat tgtcaatggg atcaccatcg acctgggtct catgaacagc       300
     acgacgtacg atccggaaac gggaattgcg tcgatacaac caggcggtac gtgggcgaag       360
     tcttatcaag aactggagaa gcaggggcgc atggtcgctg gtggccgcga aggaaaagtc       420
     ggtataggcg gtttactaac aggcggggga aagacatttt atacatgccg taacggattt       480
     gcgtgcgacc aggtcgtcaa ttatgaactc gttctcgccg acggctctat ctctaatgcc       540
     aattccacca cgaatccaga ccttttccgt gccctcaaag gtggcgggaa taacttcggt       600
     gtcgtcacgc gcttcgatat gacgactttc tcagccgtag atgtctggga ttgtacgata       660
     acgtatccaa aaaaggcgac gttgcagctt tcagaggcca tcgtggatct gacgaagaac       720
     cttgccgctt accccgatga tcatatattg gcgatgtgga cgtatctacc gaagacggaa       780
     gagcactttg ttatggtgaa tatgatgaat cttgaaggcg tgaaggaagc gagaacattg       840
     gaaaagttcc tgggcattcc ggaacagatg aatagggtcg atacgactgt gtcagttgcg       900
     acgaagctga cttcgtttgt tgtcccttcg gggaagtatg atacatggta cactacaaca       960
     tttaaagccg acccacagat catcctaaaa agcgcctctg tcttcgaatc actagtctca      1020
     gctctcaaga accaggtccc atactcaaac ttctacactc agattgtcct tcagcctctc      1080
     cctgtctcat tcggtgcaca ctccacagcc cgtggtggaa atatgatggg tctcgatcaa      1140
     atgaaggttg attgcgtcct tctggtctgg gcggttgagg ttgacacgcc cgagctgaat      1200
     gcgaatgttg ccggcccgac tctgaagagt gccattgaga agattgagac gtatgcgagg      1260
     agtgtgaagg gggatgtagg tttccgatat ctaaactact gtgataagga gcaagatgcg      1320
     ctggggagct atggtgagga gaatgtgagg catatgaagg aggttgcggt attttctgag      1380
     aaagtcgcag aggacgttgt gcgcctaagc taa                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page