(data stored in ACNUC16935 zone)

EMBL: BN001307.PE103

BN001307.PE103       Location/Qualifiers
FT   CDS_pept        join(279667..279851,279919..280147)
FT                   /locus_tag="ANIA_08963"
FT                   /old_locus_tag="AN8963.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007894"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007894"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007894"
FT                   /db_xref="GOA:Q5ARW7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW7"
FT                   /protein_id="CBF84559.1"
FT                   /translation="MAPAAAKAERLPRPATDYERWLGDDEQHLDSVRQYDLDQGQKDYT
FT                   NDGVITVAEDSSPPEIVDSDDLGSSPLSSDESSQPRHHYTRPTVPDIVALYAAIIIAVL
FT                   LVLKLHGSLRRPQWRRSEEKKRQGSPLGRDTND"
     atggctccag ctgctgccaa agctgagaga ctgcccaggc cagcaacgga ctatgaacgc        60
     tggcttgggg atgatgaaca gcaccttgac tcagtgcgtc aatacgacct tgatcaaggg       120
     caaaaagatt acaccaatga tggagtgatt accgtcgctg aagattcaag cccgcctgag       180
     atcgtggaca gcgacgacct tgggtcttct cctctatcct ctgacgagtc ttcccagccg       240
     aggcatcact acacccgccc aactgtcccc gatatcgttg cattatacgc agcgataata       300
     atagctgtcc tcctcgtcct aaaacttcat ggatcactca gaagaccaca atggcggaga       360
     tcagaggaaa agaagagaca ggggtcccca ctcggaaggg atacaaatga ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page