(data stored in ACNUC16935 zone)

EMBL: BN001307.PE105

BN001307.PE105       Location/Qualifiers
FT   CDS_pept        284103..286727
FT                   /locus_tag="ANIA_08961"
FT                   /old_locus_tag="AN8961.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007896"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007896"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007896"
FT                   /db_xref="GOA:Q5ARW9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW9"
FT                   /protein_id="CBF84563.1"
FT                   /translation="MIKPEPTRTKNQAPRFYRQYIDENDSLSAAPSPVSSLLPPHLRTP
FT                   SLPSSRNEAKDATGRAQPRRSLDIASKALGIKSLTLNSTDAVTQTTAPLLDARPTLTLH
FT                   LPNGRVLPPLSPTASNFSPRVRSSSLGQTGSQHVGQASGTGHYRSASHTFSSPTTPIAI
FT                   LHPPRPPYCNASSGPLLFRNPVPSPVITIREPSPPPSESRSAVQTQTQSRKNSTDLGET
FT                   ATARLEQVPGGAAAFSGRVEKSVSAPDALASGDPLLRQSGSRPSLEDNTYSHDHTPDIA
FT                   GRREVRQRETNAPNPCQETEEPMLDNISDKAPLSPPAHRSSFDSSNNQRSRGRSMELTR
FT                   TKHVRRPRHRASTQPLQMADPMFISISGKEFSSQGNGGSSRSSLETSSRDRSLTLPGSL
FT                   PQQPNDNTSTNSLQTTVRGSVPDTRSVAVTRLTSLNSHPPSSVIEREHTRSQSLDVNHH
FT                   SGPPAVPRHIYASLPLPRIRLPSIHSKADASSAQATDSEATISHSAGPASSLPTGPRTP
FT                   THAVFPHPQPQPQPQSEAMFTSRASSLPVTTPPAFSSPAPNSHSALQSLSPHLEAHQPT
FT                   TRLSLSKFTTQSLTTLRAVASASKIHSSSTSLSTPRSKSNSSSSSNSTASASTTSVLTP
FT                   QSPPFRPPSPTDTSNLPLATLTQHMKTQLGQARHLLATLSHHLPPAENIWIHDTVSDAE
FT                   GTVREILMLTEPLRVDREVNNGKLGLKTQLKWAVRGSWKAKDMRARLNLCYSSLVAILM
FT                   RLQDYEAEYAESVAEHAAAKTETMTSDDRNPMTSTNVHVEGPTTSELESLHKYSAMQME
FT                   GLSLESVVDEHTGIETRSAGPQSPISTISREESIEPAPEKLDNELVDMLSWRWSQGREK
FT                   TTQ"
     atgatcaagc cggaaccaac gaggacgaaa aaccaggctc cacggttcta ccggcaatat        60
     attgatgaga acgactcact cagtgcggca cccagtccgg tatctagctt gcttccaccc       120
     caccttagaa cgccgtcctt accatccagt cgcaatgagg caaaggatgc cactggtcga       180
     gctcaaccgc gacgttcctt ggatatagcc tccaaagcac tgggcatcaa gagtttgacc       240
     ctcaacagca cagatgctgt gacccagacc acggcgccgc ttttagatgc gcgcccaacc       300
     ctcaccctcc atcttcccaa cggacgcgta cttcctccac tctctccaac agcatcaaac       360
     ttcagtcccc gcgttcgatc gtctagctta ggccaaactg gcagtcaaca tgtcggtcaa       420
     gcttcaggta ccggtcacta ccgtagtgcc agtcacacgt tttcctcacc taccacacca       480
     atagcgatac ttcacccgcc gcggccccca tactgcaatg cgagcagtgg ccctctcctc       540
     tttagaaacc ctgtcccaag ccccgtgata acaattcgag agccttcacc cccgccatcg       600
     gagtcgcgat ctgcagtcca gacccaaaca caaagtcgaa agaacagcac tgatcttggt       660
     gaaacggcga cggcccgact cgaacaggta ccaggaggcg cagcggcgtt cagtggacgc       720
     gtggagaaga gtgtttctgc gcctgacgct ttagccagcg gagatccctt gctacgacag       780
     tcaggctcgc ggccttcttt ggaggataat acctacagtc acgatcatac tcctgacatc       840
     gcaggacggc gcgaggttcg gcaaagagag acaaacgcac cgaacccatg ccaggagaca       900
     gaagaaccca tgctagacaa tattagcgat aaggctcctt tgtctccacc agcacatcgg       960
     tcttcttttg atagcagtaa caatcaacgc tctcgcggcc gtagtatgga gctcacgaga      1020
     acaaagcatg tccgacgtcc ccgccaccgg gcatcaacac aacccctgca gatggcagac      1080
     ccgatgttca tctccatatc aggcaaagag ttctcgtcac agggtaacgg cgggagctca      1140
     cgttcgtcgc ttgaaacttc tagtcgcgat cgcagcctta ccctcccggg aagcctgccg      1200
     cagcaaccga acgacaatac atcgaccaat tctcttcaaa cgacagtgag agggtcagtt      1260
     ccagacacga gatcggtagc agtcaccagg ctcacctctc ttaactcgca cccaccatcg      1320
     tcggtgatag agcgggagca tactcgaagc cagagtttgg atgtgaacca ccattcgggt      1380
     cctccggctg ttcctcggca catatatgcg tctctcccct tacctaggat cagattaccc      1440
     tctatacatt ctaaggcaga tgcgtcctct gcacaggcca cggactcgga ggcaacaatc      1500
     tcccactctg caggtccagc ttcatccctt ccaactgggc cgcgaactcc aacgcatgct      1560
     gtatttcctc atccgcaacc acagccacaa cctcaatctg aagccatgtt tacctcccgg      1620
     gcgtcgtcac tgcccgttac aacaccacct gcattctctt cgccagcacc caattcacac      1680
     tccgctctcc agtcactatc accgcaccta gaagctcacc agcccacaac ccgtctatct      1740
     ttgagcaagt tcaccaccca aagtctcacc acgctacggg cagttgcatc tgcatccaag      1800
     atccactcat catcaacttc attgtcgacc ccgaggtcca agtctaactc cagctccagc      1860
     tcaaattcga cggcctcagc gtcaacaact tcagtcctaa ctccccagtc accgccgttt      1920
     cgacccccct cgccaacaga cacttccaat ctacccctag ccaccctaac gcagcacatg      1980
     aagactcaat taggtcaagc gagacacctt ctcgccactc tatcccacca tctccctcca      2040
     gcagaaaaca tctggatcca cgatacagta tctgatgcag agggtacagt ccgcgagatc      2100
     ctgatgctga ccgagccatt gcgggtagac cgagaagtca acaatggcaa actaggtctc      2160
     aagacgcaac tcaaatgggc ggttcggggc tcatggaagg ccaaagacat gagggcgaga      2220
     ctgaatcttt gctattcaag tctggtggca attttgatga gattacagga ttatgaggcg      2280
     gagtacgctg agtctgtcgc tgagcatgct gccgcgaaaa ccgagacgat gacgtcagat      2340
     gataggaacc caatgacaag cactaatgtg catgttgagg gacctaccac gagcgagtta      2400
     gagagtctgc acaaatattc agcaatgcag atggagggtc tatcgttgga gtcagtcgtc      2460
     gacgagcata cggggataga gacacgttca gcaggcccgc agagcccgat ctctacaata      2520
     tcaagagaag agagcataga gcccgctcca gagaaactgg acaatgaatt ggtggacatg      2580
     ctatcctggc gatggtcgca ggggcgggaa aaaacaacgc agtga                      2625
//

If you have problems or comments...

PBIL Back to PBIL home page