(data stored in ACNUC16935 zone)

EMBL: BN001307.PE107

BN001307.PE107       Location/Qualifiers
FT   CDS_pept        join(289633..289918,289973..290589)
FT                   /locus_tag="ANIA_08960"
FT                   /old_locus_tag="AN8960.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007898"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007898"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007898"
FT                   /db_xref="GOA:Q5ARX0"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX0"
FT                   /protein_id="CBF84567.1"
FT                   /translation="MAATAQSQSEEVAVEIKANATVHNREIGTDESVLFEDTRTPHAPQ
FT                   APSTMNIAIRPNAPQDLPVLLSRVSKLGASYAQNEDEDIRAEYLDAGPPSRSLPATAEN
FT                   AFNVRRAHYAAIETCVDLGVFVSLSKDDTPKTVAELAKATHADPLLLCMLLPQRVLLFS
FT                   PIWHADKPARLLKHLSTMGVIIETSEDTYLCNGFSTSLSNKRYSDAYPCMFARYLPLYS
FT                   SFQQSPLIPSLGPTASHTASPACPRFSREPTTPTQAMVAIPRSKTDNASASTSSNSPRN
FT                   TSPTAQSSITTGQPTVRPT"
     atggctgcga ctgcccaaag ccaaagcgag gaagttgccg tggagataaa agcaaacgct        60
     accgttcata atcgcgagat agggactgac gaaagcgtcc tttttgagga cacacgcacc       120
     ccacacgcac cccaggcgcc ttcgacaatg aacattgcta tccgtccgaa tgcgcctcaa       180
     gaccttccag ttctgctcag tagggtgagc aagctcggtg catcatacgc acagaacgag       240
     gacgaggata ttcgagccga atacctggat gcgggcccgc cgtctcgttc gctccccgca       300
     acagcggaga atgcatttaa tgtacgcaga gcacactacg ctgcgattga gacctgtgtc       360
     gacctcggcg tcttcgtttc gttgtcgaaa gatgatactc ccaaaacagt ggctgagctc       420
     gccaaagcta cccatgctga tcctttgctt ctctgtatgc tgctccccca aagggttcta       480
     ctcttctctc ccatctggca tgctgacaag ccagcccgcc tcctcaagca tttatccacc       540
     atgggtgtca tcatcgaaac aagcgaagac acctatcttt gcaacggctt ttccacgtct       600
     ttgagcaata agcgctacag cgacgcctac ccatgcatgt tcgctcgtta tcttccccta       660
     tattcctctt ttcagcaaag tccgctgata ccgtcgttag gaccaactgc atcacatacg       720
     gcatcaccag cctgccctcg tttctcaaga gaaccaacta caccaaccca agcaatggtt       780
     gccataccgc gttccaagac ggataacgca tcagcaagca cttcttcgaa ttccccaaga       840
     aacacctcac ctacggcgca gagttcaata accacaggac agcctaccgt caggccgacc       900
     tag                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page