(data stored in ACNUC16935 zone)

EMBL: BN001307.PE108

BN001307.PE108       Location/Qualifiers
FT   CDS_pept        complement(join(291627..292066,292162..292264))
FT                   /locus_tag="ANIA_08959"
FT                   /old_locus_tag="AN8959.4"
FT                   /product="benzodiazepine receptor family protein
FT                   (AFU_orthologue; AFUA_3G01430)"
FT                   /note="transcript_id=CADANIAT00007899"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007899"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007899"
FT                   /db_xref="GOA:Q5ARX1"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX1"
FT                   /protein_id="CBF84569.1"
FT                   /translation="MPWSFVLPQAIFASPLLATLTPVATGSTIGYLVNRYGTKPKYHAL
FT                   KQPPASPPSWLFPPVWTLLYGLTGYASYHFTVNTLEPDTTITQTLYTAQLFLNHLWMPL
FT                   FFAARKPILAAGDIVLLGGTVATLMRELWGSDRVSFWLFAPYAAWLGYATYLNFGTGIL
FT                   NNWRIPDVPEERKRRNE"
     atgccgtggt ccttcgtcct cccgcaggcg atcttcgcct cgccactact tgcaacttta        60
     acgcccgtcg cgacgggctc aacaataggc tacctcgtaa accgctacgg cacaaaaccc       120
     aagtaccatg ccctcaagca accgccagcc tcaccaccct catggctctt tccgccagtc       180
     tggactctcc tctacgggct aactggttac gcctcctacc acttcacggt gaacactctg       240
     gaaccagaca ccaccatcac gcagacgctg tacaccgctc agttattcct caaccacctc       300
     tggatgccgc tcttctttgc agcgaggaag ccaatcctgg ccgcagggga tattgttctt       360
     cttggtggga cagtggctac gctcatgagg gagttgtggg ggtccgacag agtgagcttt       420
     tggctctttg caccgtatgc ggcttggctg ggatatgcga cgtacctgaa ttttggaacg       480
     gggattttga ataattggag gattcctgat gtcccagagg agaggaagag gagaaatgaa       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page