(data stored in ACNUC16935 zone)

EMBL: BN001307.PE109

BN001307.PE109       Location/Qualifiers
FT   CDS_pept        complement(join(292710..293443,293521..293584))
FT                   /locus_tag="ANIA_08958"
FT                   /old_locus_tag="AN8958.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007900"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007900"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007900"
FT                   /db_xref="GOA:Q5ARX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX2"
FT                   /protein_id="CBF84571.1"
FT                   /translation="MSSLLQAKPHLTAALSFLAFGASACRNIIESSEGAPGPPQRTDKS
FT                   ALLSEWPGSNGIKRETQKTHWVTSLVALQVDVPVAQLVRCGISEVGDAYDLARNLFSAF
FT                   LDARARGLEAWFLDKDVPQLSFTPWSLLFGRSHSAGAFMLGHWSSARRIQLDQPILHSE
FT                   TANPICEFRPSKAMITASNINAETDAAGTVLYWKFPRRSVDQVDKAASYGIPWRLMEGA
FT                   FQEFIVEKITSETTKVTYVTVGCGNMYPGGQRERTSKGAVVVV"
     atgagcagtc tcctccaagc caagccccac ctcacagcag ccctctcttt cctcgcattc        60
     ggtgccagtg cttgtcgtaa tatcatcgag tcgtccgaag gagcaccagg acctccacag       120
     agaacagata agtcagcctt gctttcagag tggccgggtt caaatgggat caagcgcgaa       180
     acgcagaaaa cgcactgggt gacttcgctt gtggcgctgc aggttgatgt tcccgttgca       240
     cagctggtga ggtgtggaat aagcgaagtc ggagacgcat atgatcttgc aaggaatctg       300
     ttctctgcgt tccttgacgc tcgagcaaga gggctggaag cgtggttcct ggataaagat       360
     gttccgcaac tatccttcac tccgtggagc ttgttgtttg ggaggtcaca tagtgcgggg       420
     gcgtttatgc taggtcactg gagctctgca cgaaggatac agctggacca acctattcta       480
     cactctgaaa cggctaaccc tatctgcgaa ttccggccga gcaaggcgat gatcacggcc       540
     agcaacataa atgcagaaac agacgcagca ggaaccgtcc tctactggaa gtttccacgc       600
     cgctcagtcg atcaagtcga caaagcggcc tcttatggaa tcccctggcg attgatggaa       660
     ggcgcattcc aggagttcat tgtggagaag atcacaagtg agacaacgaa agttacatat       720
     gtgaccgttg ggtgcggaaa tatgtatccc ggcggacaaa gggaaaggac ttcaaaaggt       780
     gccgtggtgg ttgtataa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page