(data stored in ACNUC16935 zone)

EMBL: BN001307.PE112

BN001307.PE112       Location/Qualifiers
FT   CDS_pept        complement(join(305462..305891,305951..306293,
FT                   306383..306567,306627..306847,306895..306982,
FT                   307051..307205))
FT                   /locus_tag="ANIA_08955"
FT                   /old_locus_tag="AN8955.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007903"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007903"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007903"
FT                   /db_xref="GOA:Q5ARX5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX5"
FT                   /protein_id="CBF84576.1"
FT                   /translation="MEDKKVVLDSGSSEELEQGFSSNGNGYDTVATKKLIRKIDFVLIP
FT                   WLALLYLLSFLDRTNIGNARLAGLETDLNMSGLDYNVALAIFFPFYVAAEIPSNIMMKR
FT                   SRPSLWIPSIMIAWAVVCSLMGLVQNYAGLLVARAALGIAEGGLFPGVTFYITMWYKRH
FT                   ECGLRMAIFFSAATAAGAFGGLLARGIGEMDGIGGKGGWAWIFIIEGILTFVIAKFLTS
FT                   AEKAEVQRRLEEDRSSLADEYNMKFFWDAIKDWKIWVHMFVTVGVYTPLYSFSLFLPTI
FT                   VSSLGYENEEAQLMTVPPYVVACVFCIGGGFLADRQGQRGIYMIGFNIVAIIGFIMLIS
FT                   SDNNGVKYAGTFFAASGIYPNVPQGVAWNGNNIGGSFKRSVGIAMHVGCGNLGGVLSSF
FT                   IYRSQDKPHYRVGHGTLIGCLTMSTVLCTIMTIYLRRENARRDREYKPPAEYSEAERAA
FT                   EREKGDDASFFRYTI"
     atggaggata aaaaggtcgt tctcgatagt ggcagtagcg aggagttaga gcagggcttc        60
     agttccaatg gcaatggcta cgataccgtc gcaaccaaga agttaattcg caaaattgac       120
     tttgttttga ttccgtggct tgctcttctc tacttactga gtttcctcga ccgcactaat       180
     atcggcaatg cccgtctggc tggtcttgag acggatctga acatgtctgg tctggactac       240
     aatgtcgcct tggcaatttt cttccccttc tacgtcgccg ctgagatccc ctcaaacatt       300
     atgatgaagc gctctcgccc gtctctctgg attccttcga taatgattgc atgggcagtt       360
     gtctgctcac tcatgggtct ggtgcagaac tatgctggct tgcttgttgc ccgtgcagcg       420
     cttggtattg ctgaaggtgg tctctttccc ggtgtcacat tttacatcac aatgtggtat       480
     aaacggcacg aatgcggcct ccgcatggct atcttctttt cagccgccac agcagccggt       540
     gcattcggcg gccttcttgc acgcggcatt ggcgagatgg acggaattgg tgggaaggga       600
     ggatgggcct ggattttcat cattgagggt atcctcactt ttgtcattgc gaaattcctc       660
     acctctgccg agaaggccga agttcagcgc cgcctggaag aagaccgctc ttccctcgcg       720
     gatgaatata acatgaagtt cttctgggac gccatcaagg actggaagat ctgggtgcac       780
     atgttcgtca ctgttggcgt gtacacaccg ttgtactcat tctctctgtt cttaccgacc       840
     attgtctcca gtcttggtta tgagaatgag gaggcgcagc ttatgacggt cccgccctat       900
     gtggtggctt gcgtattctg tatcgggggt gggtttctgg cagatcgcca gggacagcgt       960
     gggatttata tgattggctt caatattgtt gcgatcatcg gcttcataat gctcatctca      1020
     tccgacaaca acggtgtgaa atatgcaggg acctttttcg ccgcctcagg aatctaccct      1080
     aacgtcccac aaggcgtcgc ttggaacggg aacaatatcg gcggctcatt caagcggagt      1140
     gtgggtatcg ccatgcatgt cggctgcggc aatctcggcg gtgttttgtc ttcgttcatc      1200
     taccggtcac aggataaacc gcattatcga gttgggcatg gtacgctgat tgggtgtctg      1260
     actatgagca ccgtcctgtg caccatcatg acaatttatt tgaggagaga aaacgcaagg      1320
     cgcgatagag agtataaacc gccggccgaa tactcggagg cagagagggc agctgagagg      1380
     gagaaaggag atgatgcgag tttctttcgg tacacgatct aa                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page