(data stored in ACNUC16935 zone)

EMBL: BN001307.PE114

BN001307.PE114       Location/Qualifiers
FT   CDS_pept        complement(join(309909..310473,311092..311521,
FT                   311587..311625,311808..312216))
FT                   /locus_tag="ANIA_08954"
FT                   /old_locus_tag="AN8954.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007905"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007905"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007905"
FT                   /db_xref="GOA:Q5ARX6"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX6"
FT                   /protein_id="CBF84580.1"
FT                   /translation="MSDRKLILVMGILALRALPLSRVRRIPDGIARNSSLTWRMIALSS
FT                   SGRYDVRVLTRNTASEQARKMVVLPQVTLQQGFQETRQISTLPSPAYTAPGRLYARGKS
FT                   ELIYGIRAYEIARHHGVKHYVFANIDYTLRKAGKEDGSFAWENPAADGKIPLIALDDVG
FT                   VYSLWLFDNPSQSAGLNLEVATDQVSFAEIATTFTKVTRKKGIHKRLSLDEYLDEAELY
FT                   PGAYANWAVASDVPRDESFMTWRENFTAWWGYWSEGKGATRDMALMDRIHPSRIPSLEA
FT                   WMRMKGYDGRPRLHPPYPIIMASFLVDGRFPPVPLPPSKDIKSEERSTAIDFVNRHNLI
FT                   FQEFNYDKVTATFLPDAIVYHSHGTIRGHAEIKQFLENVYGFFIPGIGRSATNHVVDRD
FT                   ENGGVVVRYQETLIRYGWGEGEPDADVVAGRDIVRADGLPAIWWFGQVVDRLRIAANGW
FT                   RILERYLGGSFRNQSLDLTNKV"
     atgtcagaca gaaagttgat ccttgttatg ggaatactgg cgctcagggc actcccgttg        60
     tcaagggtac gtcgcattcc agacgggatt gcgaggaaca gcagtctaac atggagaatg       120
     atagcccttt cctcaagtgg ccgctacgat gtccgagtac tgactcgaaa taccgcctca       180
     gagcaggcta ggaaaatggt tgtgctacct caggtaacgc tccagcaagg cttccaggaa       240
     accaggcaga tctccacgct gccttcgcca gcgtatacgg cgcctggacg gctttacgct       300
     cggggaaaaa gcgagctgat ctacggtata cgagcgtacg agatcgctcg tcatcatggc       360
     gtcaaacact atgttttcgc gaatatcgac tatactctcc gtaaagcagg aaaagaggat       420
     ggttcatttg cttgggagaa tccggctgcg gacggcaaga tcccgctcat tgcactcgac       480
     gacgtcggag tctacagcct ctggcttttt gacaacccct cgcagtccgc aggccttaac       540
     ctcgaagtcg cgacagatca agtaagcttc gccgagatag cgaccacttt cactaaggtt       600
     acgagaaaaa aaggtatcca caagcggctt tctttagatg agtacctgga cgaggccgag       660
     ctgtatccag gagcgtatgc aaactgggcg gtggcctcgg atgtgcctcg cgacgagtca       720
     tttatgacct ggcgggagaa tttcacagcc tggtgggggt attggagtga gggcaaaggt       780
     gcaacaagag atatggcact gatggatcgg attcacccgt ctcggatccc aagtttggag       840
     gcgtggatga gaatgaaggg gtatgatggc cggccaaggc tccatcctcc atacccgatc       900
     atcatggcct cattcctcgt agatggacga ttcccgcccg tcccattgcc tccatcaaaa       960
     gatataaaaa gcgaagaaag aagcacggcg attgacttcg tcaaccgtca caacctcatt      1020
     ttccaagaat tcaactacga caaggtgaca gccacgtttc tcccagacgc catcgtgtac      1080
     catagccacg gcacgatccg aggtcacgcc gagatcaaac aattccttga gaatgtgtat      1140
     ggattcttca tccctggcat tggtcgcagt gctacaaacc acgttgttga ccgcgatgag      1200
     aacggaggcg tcgtggtcag atatcaagag actctaatta gatacgggtg gggcgagggc      1260
     gaacccgatg cagatgttgt tgctgggcgc gacatagtga gggccgatgg attgccagcg      1320
     atctggtggt ttggacaggt cgttgatcgc ttgaggattg ccgcgaatgg atggagaatc      1380
     ttggagcggt acttgggggg ttctttcaga aatcagagct tggatttgac caacaaagtg      1440
     tga                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page