(data stored in ACNUC16935 zone)

EMBL: BN001307.PE115

BN001307.PE115       Location/Qualifiers
FT   CDS_pept        complement(join(313255..313922,313981..314114,
FT                   314172..314307,314380..316309))
FT                   /locus_tag="ANIA_08953"
FT                   /old_locus_tag="AN8953.4"
FT                   /product="Alpha-glucosidase BPutative uncharacterized
FT                   protein Precursor ; [Source:UniProtKB/TrEMBL;Acc:Q9C1S7]"
FT                   /note="transcript_id=CADANIAT00007906"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007906"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007906"
FT                   /db_xref="GOA:G5EB11"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR031727"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB11"
FT                   /protein_id="CBF84581.1"
FT                   /translation="MRFQQLLPWAAALTGCVVAQSQAGVDPLDRPGNDLYVKDLSNCTG
FT                   YKVTKHWKTRSGFYADLALAGPACNVYGIDLPKLKLEVEYQTDERLHVKILDTNNTVYQ
FT                   VPDSVFPRPGFGQWCSPKNSKLKFDFKPDPFSFTVSRTDTGEVLFDTTGTKLVFENQYL
FT                   YLKTHLPQNPHLYGLGEHSDSFMLNTTNYTRTIYTRDAYGTPQGQNLYGAHPIYFDHRQ
FT                   DGTHGVFLLNSNGMDIYIDNEGGQFLEYNIIGGVFDFYFIAGPSPQDVARQYAEIVQPP
FT                   LMVPYWGLGFHQCRYGYQDVYEVAAVTANYSVHDIPLETIWTDIDYMDRRRIFTLDPER
FT                   FPPELVKDLVDTLHARDQHYIVMVDPAVYYSEPNPALDAGLKYDAFMKELNGTHYQGVV
FT                   WAGPSYFPDWFHPNAQEYWTEQFLNFFDGVNGPDIDALWIDMNEPANFYNRPYPGNNTT
FT                   PEEFAEANDNPPEPPAVRDGPDAPIPGFPDSLQPNFASGQTNEKRAVVTVERRARSQSH
FT                   RQLGAGRWRSAVRHWPRDPKAGWQHGRKSGSGCGPHECRGLPNRELIRPPYMIQNGAGP
FT                   TLADNTADTDIVQSGGYVQYDTHSLYGAMMSTHSHNAMRARRPDDRALVITRSTFAGSG
FT                   KDVSHWLGDNISDWLSYRLSISQILQFASLYQIPVVGPDVCGFGGNVTETLCARWATLG
FT                   SFYTFFRNHAEIFANPQEFYRWPIVAEAARNGIAIRYQLLDYIYTAIYKQTQTGTPSLN
FT                   PLFFNYPFDQNTYGIDLQFFYGPGILVSPVTEENSTSVSYYLPDDIFYEWGTGKPVRGH
FT                   GEYVSAEVDVTHITVHYKGGLVYPQRIESANTTTALRQKGFNIVIAPGLDGSAHGELYL
FT                   DDGLSQVQDKVSEIDFSYVDGVFEMKGSFEYDPGVGIERITILGVGAKPEVAAEDAEVE
FT                   YDEENQKLVLHVDVPLTRKSSIKIA"
     atgcgctttc agcagctgct tccatgggct gcggccctga ctggctgcgt cgtcgcccag        60
     agccaggccg gcgtcgatcc gctcgaccgt cccggcaatg acctctacgt aaaggacctt       120
     tcgaactgca ctgggtacaa ggtcaccaag cattggaaga cccgatccgg tttctatgcg       180
     gacctggcgc tcgccgggcc agcatgcaat gtgtacggaa tcgatttgcc caagctgaag       240
     ctcgaagtcg agtatcagac cgatgagcga ctgcacgtca agattctgga taccaacaac       300
     acagtttacc aggtgccaga cagcgtcttc ccgcgcccgg gcttcggcca gtggtgctcg       360
     cccaagaact ctaagctcaa gtttgacttc aaacctgacc cgttctcgtt caccgtctct       420
     cgcacagaca ccggcgaggt gctcttcgac accaccggca ccaagctcgt gttcgagaac       480
     cagtatcttt atctgaagac gcacctgccg cagaacccgc atctgtatgg tctgggagag       540
     catagcgact ccttcatgct caacaccacc aactacaccc gaacaatcta cacccgtgat       600
     gcttacggga cgccccaagg ccagaatctg tacggggctc acccgatcta tttcgatcac       660
     cggcaggacg gcactcacgg tgtgttcctg ctcaactcca acggtatgga catctacatc       720
     gacaacgagg gcggccagtt cctcgagtac aacatcatcg gcggcgtttt cgacttctac       780
     ttcatcgccg gaccatcccc gcaagatgtg gccaggcagt atgctgaaat tgtccagccg       840
     cccctgatgg ttccatactg gggactcggt ttccaccagt gcaggtacgg ctaccaggat       900
     gtctacgagg tggccgctgt caccgccaac tactccgtcc acgatatccc actggagacc       960
     atctggactg atatcgacta catggaccgt cggcgcatct tcacgctcga tcccgaacga      1020
     ttcccaccag agctggtcaa agaccttgtg gacactcttc acgcgcgaga tcagcattac      1080
     attgtcatgg ttgatccggc tgtctactac agcgagccaa acccggcgct tgacgccggt      1140
     ctgaagtacg atgcgttcat gaaggaactg aacggcactc attaccaggg tgtcgtttgg      1200
     gccggtccca gttacttccc tgactggttt cacccgaacg ctcaggaata ctggacggag      1260
     cagttcctca acttcttcga cggcgtcaac ggcccggaca ttgatgccct gtggatcgac      1320
     atgaatgagc ccgccaactt ttataaccgc ccctacccag gcaacaacac caccccggag      1380
     gagtttgccg aggcgaatga caacccccct gagccaccgg ccgtgaggga cgggccagat      1440
     gcccctatcc ccgggttccc ggatagtctc cagccaaact tcgcttctgg ccagacaaac      1500
     gagaagcgcg cagttgtcac cgtcgaacgt cgggctcggt ctcaatcgca ccgccagctc      1560
     ggcgctggcc gctggcggtc tgcagtccgc cactggccgc gagacccaaa ggctggctgg      1620
     cagcacggcc gcaaatccgg ctctggctgc ggcccccacg agtgcagagg tctgcccaac      1680
     cgcgagctca tcaggccgcc gtatatgatt cagaacggcg ccggcccaac gctggcggac      1740
     aacactgcgg acacggatat cgtgcaaagc ggcggatacg tccagtacga cacgcacagc      1800
     ctttacggcg cgatgatgtc cactcattcg cacaatgcca tgcgggctag acgtcccgat      1860
     gaccgcgcat tggtgatcac caggagcaca tttgccggct ctggaaagga tgtctcgcac      1920
     tggcttggag ataacatctc cgattggctt tcataccgac tgtccatctc ccagattctc      1980
     cagttcgcct cgctctacca gatccccgtt gtcggccctg atgtctgcgg cttcggtgga      2040
     aacgtaactg agaccctctg tgccagatgg gctaccctcg gctccttcta cactttcttc      2100
     cgcaaccacg ccgagatctt tgccaatccc caagagttct accggtggcc gatcgtcgcc      2160
     gaagcggccc gcaacggcat tgccattcga taccagctgc tcgactacat ttacacagcc      2220
     atctacaagc agacccaaac tggcacacca tcccttaacc cgctcttctt caactacccc      2280
     ttcgaccaaa acacttacgg catcgatctc cagttcttct atggccccgg catccttgtc      2340
     tctccggtca cggaggaaaa cagcaccagt gtttcctact accttcccga cgacatcttc      2400
     tatgaatggg gaactggcaa gcccgtccgc ggacacggcg agtacgtctc cgccgaagtc      2460
     gacgtcaccc atatcacggt gcactataag ggcggtctcg tctatccaca gcggatcgag      2520
     agcgcgaaca ccacaactgc gctgcgccag aagggattca atatcgtcat tgcaccgggc      2580
     ttggatggct ctgctcatgg agagctttac cttgacgatg gcctgtcgca ggtgcaggat      2640
     aaagtctccg agattgactt tagctatgtc gatggcgtct ttgagatgaa gggctcgttt      2700
     gagtatgacc caggcgtcgg aatcgagcgg attactattc tgggtgtggg ggccaagccc      2760
     gaggtggcgg ctgaggacgc ggaggtcgag tatgatgagg agaatcagaa gctggtgctg      2820
     cacgtcgatg tacccttgac gcgaaagtca agtatcaaga ttgcttga                   2868
//

If you have problems or comments...

PBIL Back to PBIL home page