(data stored in ACNUC16935 zone)

EMBL: BN001307.PE117

BN001307.PE117       Location/Qualifiers
FT   CDS_pept        join(322496..322669,322741..323121,323158..323228,
FT                   323377..323824)
FT                   /locus_tag="ANIA_08951"
FT                   /old_locus_tag="AN8951.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007908"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007908"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007908"
FT                   /db_xref="GOA:Q5ARX9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX9"
FT                   /protein_id="CBF84585.1"
FT                   /translation="MASEPSAAYLAEDRSQPALIGIVVVTALSAVVVIVRLYARRVLVR
FT                   GLGWDDLFIVLAQLVSWATMALCSQILRYGSGRHLVALLKTPETLVRMYKWLVTTQMVY
FT                   MFNLWLCRVSGLTFYARLNPMPRFILYLRLSFAFVTAVWAAQSLIIALQCIPLEALWDN
FT                   SITDKKCMGSAMVFISTGALTIIVMGLQAKTARKLALLGILCFGVLTSILRMVSMIVSV
FT                   QHEDDATWYFSPVVAWTCAEISAAIIALSLPALRAIFGFLKEHHSTRGKSNSYPNTGSG
FT                   SKGIGLDSLSKSATKQPKVFHGSGVYDNTVDIGVGRSPSQEVLWNGYGDRSYGNRGNGS
FT                   PREIMITETVDVEVGRG"
     atggcttcag agccctctgc tgcctacctg gcagaagacc gcagccagcc cgccctgatc        60
     ggaatcgtgg tcgtcacggc cctgtcagcg gtagtcgtta tcgttcggct ttatgcacga       120
     cgagtcctgg ttcgcgggct gggctgggat gaccttttta tcgtgcttgc gcagctagtc       180
     agctgggcaa caatggccct ctgctcgcag atcctccgct acggatctgg ccggcacctt       240
     gtcgcgcttt taaagacccc agaaaccctg gtgcgcatgt acaagtggct cgtcacaaca       300
     caaatggtgt acatgttcaa cctttggctc tgccgcgtct ccgggctgac cttctacgcg       360
     cgactgaacc ctatgccgcg attcatcctg tacctgcgcc tgtcgtttgc gtttgtgacg       420
     gccgtctggg ccgcgcagag cttgatcatt gcgctgcaat gcatcccact cgaggcgctg       480
     tgggataatt ctattactga caagaaatgc atgggttccg ccatggtgtt tatatctacg       540
     ggcgctctga cgatcattgt catggggttg caggcgaaga cggcgaggaa attggcacta       600
     ctgggaatct tgtgttttgg ggttttaacc tccatcctcc gcatggtatc catgatcgtc       660
     tccgtccaac acgaagacga cgcaacctgg tacttctcac ccgtggtcgc ctggacatgc       720
     gccgagatca gcgccgcgat catcgccctc tccctgcccg cactacgagc catattcggt       780
     ttcttgaagg aacaccactc gacgcgcggc aaaagcaatt cgtacccaaa tacgggttcg       840
     gggtcaaagg gaatcgggct agactcgctt tctaagtcgg caaccaagca gccaaaagtg       900
     ttccatggga gcggagtcta tgataacacg gttgatattg gggttgggag gagtccaagt       960
     caggaggttc tctggaacgg atacggggac cgaagttatg ggaatagggg taatgggagt      1020
     ccgagggaga ttatgatcac agagacagtg gatgtggaag ttggaagggg gtag            1074
//

If you have problems or comments...

PBIL Back to PBIL home page