(data stored in ACNUC16935 zone)

EMBL: BN001307.PE118

BN001307.PE118       Location/Qualifiers
FT   CDS_pept        join(327758..327859,327908..327979,328030..328170,
FT                   328210..328270,328317..328358,328415..328459,
FT                   328510..328517,328663..328750,328791..328880,
FT                   329035..329073,329124..329204,329257..329316,
FT                   329370..329422)
FT                   /locus_tag="ANIA_09432"
FT                   /old_locus_tag="AN9432.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007909"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007909"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQJ8"
FT                   /protein_id="CBF84587.1"
FT                   /translation="MPSIRDNDLRKSPEYCHYLEAVKDGELTLPDFKIDDNGVPDIHPY
FT                   EVYCRVKGCLKRTVPSANRNILVKHLKDKNSHGMEFTLHNGPPTMKELMEAKGKSYLDY
FT                   LACLKALFSQPRLLPRSASELPPSPRTTILRVSRIPTRVKLEMIRTMARALQVIRREGS
FT                   KAAKSAGEKGTIPCKTCRNAKGKVSAPCGSKPYCEFWRFFSSIDEAKGASMQPHMDNAK
FT                   ETSNEESVLNKENEHENEEEKAAEPEEVQGDGRHVSEHLAITPFAQLNSGEDNSIATNL
FT                   DLRDFGLNLESI"
     atgccgagca ttcgcgataa cgatctccga aagtccccag agtactgtca ctatctcgag        60
     gcagttaagg acggggagct tacgctgccg gatttcaaga tagacgacaa tggcgtgcct       120
     gatatccatc catatgaagt ctactgccga gtgaagggat gcctcaagcg tacagttccc       180
     tctgccaaca gaaacatatt ggtcaagcac ttgaaggaca agaactccca cggcatggag       240
     tttacattgc acaatggacc tcccactatg aaggaactga tggaggccaa aggcaagtcc       300
     tatctagatt acttggcttg tttgaaggca ctgttctccc aaccccgact cctaccaaga       360
     agcgcaagcg agctgccacc aagtccaagg accacaatac taagggtgtc gagaattcca       420
     acgagggtga agctggaaat gatcaggaca atggcgaggg cccttcaagt gatccgccgt       480
     gagggtagca aggcagctaa atcagctggt gagaaaggaa ccataccctg caagacctgt       540
     cgcaacgcaa agggcaaagt ctcagcaccg tgtggttcaa agccatattg cgagttttgg       600
     cgctttttct catcgattga cgaggcaaag ggagcgagta tgcaacctca catggataat       660
     gcaaaagaga caagcaatga agaaagtgtc ttaaacaagg aaaatgagca tgaaaatgag       720
     gaggaaaagg ctgctgagcc cgaggaagtg cagggtgatg gcagacatgt ctctgaacac       780
     cttgcaatca ctccgtttgc gcagctgaac agtggtgagg ataatagtat tgcaactaac       840
     ctggatctca gagactttgg cctcaatcta gaatctatct ag                          882
//

If you have problems or comments...

PBIL Back to PBIL home page