(data stored in ACNUC16935 zone)

EMBL: BN001307.PE119

BN001307.PE119       Location/Qualifiers
FT   CDS_pept        complement(join(329786..329814,329963..330312,
FT                   330359..330542,330591..330712,330767..330870,
FT                   330919..330968,331017..331094,331285..331461,
FT                   331522..331702,331769..331861,332566..332659,
FT                   332719..332954,333039..333077,333232..333279))
FT                   /locus_tag="ANIA_09431"
FT                   /old_locus_tag="AN9431.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007910"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD93"
FT                   /protein_id="CBF84589.1"
FT                   /translation="MSTTPQIPGAIDVPEQNGYTYIVPLDPNRTQYHARQLERYDAQSP
FT                   YIRGRVTRIQYQCSGVRICSYLHPNLRNMHHYKVTEDDWNYIRQERQLIEETEMDPKKQ
FT                   KAISHFFGVLRVFKRHQACRPQQVGCAPKMVLGEAALIYREKLAFYPDGQDLNALQLEC
FT                   DRNEYLKHYVREIYHEGDITIIICILQDQAKLFQSLRSFEVDMSFKRVREGRFNEVIFA
FT                   VFLEDHGKVITLLRAFMNQQTGRAYYFLFKKVFEMIHDLSGHPVQFFHLHGTGIETIVV
FT                   DMDEGQRDVLFKAMISLLHAPTRAQYMDILEQLLEDPTPGVATWAEHKLHPHFNQTRMH
FT                   TNAGEQTHQKSYAFSGKHLPILKAVTSAYFLDVRDMHQYSVRIHYNITHSYRPDDEISR
FT                   ITENLIRDQRKRRRNQEIEEEENIEGVLPRRARPSRSFSSSGSPRPRRSRSSTRGRSYT
FT                   RGVSRSSTPQRSPSLAQIASQNYRDQQASHEQHILDLRERQARLDRYEVETRLMQQRLL
FT                   QPTSPQLVGVNPVQYPPLPGYLPSSSQLVNPGPVYVPQMTGALPYVPSQAPFVPSTETS
FT                   HQLVYQDSQARSFSTVSC"
     atgtctacaa ctccgcaaat tccaggtgct attgacgttc cagaacagaa cggctatacc        60
     tatattgtcc cacttgatcc gaaccggact caataccatg ctcgccagtt ggagcgttat       120
     gatgctcaat caccctatat tcgaggcagg gttactcgaa tacagtacca gtgttcaggc       180
     gttcgaatat gctcttatct ccatcctaac cttagaaata tgcaccatta caaggttaca       240
     gaagatgact ggaactatat ccgacaggag cgacaactta ttgaagagac agaaatggat       300
     cctaaaaaac agaaagcaat ctcacatttc tttggtgtgc ttcgtgtatt taagagacat       360
     caagcttgtc ggccgcaaca agtagggtgt gctcctaaga tggtacttgg cgaagctgct       420
     cttatttacc gggagaagct tgcattttat cctgatggcc aagatcttaa tgcactacaa       480
     ctagaatgcg accggaatga atatcttaag cattatgtgc gagaaatcta tcatgaaggt       540
     gatattacaa ttattatttg tatattgcaa gatcaggcca agctatttca aagcctacgc       600
     tcatttgaag ttgacatgtc cttcaaacgc gtacgtgagg gcaggtttaa cgaggttatc       660
     tttgctgttt ttttagagga tcatggaaaa gttatcacac tccttcgtgc gtttatgaac       720
     caacaaacag gccgtgccta ctattttcta tttaaaaagg tctttgagat gattcatgat       780
     ctttcaggcc atccagtaca gtttttccat cttcatggaa ccggcattga aactatcgtt       840
     gttgatatgg atgaaggaca gagggacgtc ttatttaagg caatgattag tcttttacat       900
     gcccctaccc gagcccagta tatggatatt ttagagcaat tactagagga tccaactcca       960
     ggcgtggcaa cttgggctga acataagctg catccgcatt ttaatcaaac ccgtatgcat      1020
     accaatgcag gtgaacaaac ccaccaaaaa tcatatgctt ttagtgggaa gcacctacca      1080
     attctaaagg cagttactag tgcatatttt cttgatgtac gagatatgca tcagtactct      1140
     gtgcggatac attataacat tacccattcc tatcggccag acgatgagat ctcaagaatt      1200
     acagagaatt taatcaggga ccaaagaaaa cgacgccgta atcaggagat tgaggaagag      1260
     gaaaatatag aaggagtact acctagaaga gcacgtcctt ctagatcttt ctcatcctct      1320
     ggatctccac ggccacgccg ctccaggtct agtaccaggg gtaggagtta tactagagga      1380
     gtaagccgaa gttctacacc acagcggtct ccatccctag cccagattgc ttctcagaac      1440
     tatcgcgatc agcaggctag ccatgaacaa catatacttg atcttcgtga gcgccaagca      1500
     cgtctagatc gatatgaggt agagactcgg cttatgcagc agcgtctact acagccaact      1560
     agtcctcaac tagttggtgt aaatccagtg caatatccac ctctacctgg atatttacca      1620
     tctagttcac aactagtcaa cccgggccca gtatatgttc cgcagatgac tggagctctg      1680
     ccatacgtgc cctctcaagc accatttgtt ccatctacag agactagtca ccaactagtc      1740
     tatcaagact cacaggcacg aagtttttcc acggtatctt gttaa                      1785
//

If you have problems or comments...

PBIL Back to PBIL home page