(data stored in ACNUC16935 zone)

EMBL: BN001307.PE120

BN001307.PE120       Location/Qualifiers
FT   CDS_pept        complement(join(335803..335849,336154..336544))
FT                   /locus_tag="ANIA_08950"
FT                   /old_locus_tag="AN8950.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007911"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007911"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007911"
FT                   /db_xref="GOA:Q5ARY0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY0"
FT                   /protein_id="CBF84591.1"
FT                   /translation="MAHHDPLHTAPTRRNLPIEVSYSIGPCNSSMDHNVSQLERKPDRN
FT                   DGFQRYLEATGATIYQSWHPPHTASPYPVQSDGQFHIPNSQSQNLGFPASTSSFMQPSV
FT                   AQADYHYPMNAHAPSTVMSDLPLAREKWFNRPPLLYPFQFT"
     atggcccacc acgacccgtt acataccgcg ccaaccagac gcaatttacc tattgaggtc        60
     tcatactcca tcggtccttg caactcgtcc atggatcaca acgtttccca gttggagcgg       120
     aaacctgaca ggaatgacgg atttcagcgc tatctcgagg ccaccggcgc taccatttac       180
     caatcatggc accctccgca tacagcctcg ccatatccgg tccaatcaga cggccaattt       240
     cacattccaa acagccaatc ccagaatctt gggtttcctg cctcgacgtc atcgttcatg       300
     cagcccagcg tggcacaggc ggactaccat tatccgatga acgcccacgc cccatcgact       360
     gtgatgtctg acctcccact cgccagggaa aagtggttca atagacctcc attgctgtat       420
     ccattccagt tcacttag                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page